Citrus Sinensis ID: 027992

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MLVMCHSFLFCGLVVATDDEKIAECCQQFGADVIMTSESCRNGTERCNEALQKLEKKYDIVVNIQGDEPLIEPEIIDGVVKALQAAPDAVFSTAVTSLKPEDAFDPNRVKCVVDNHGYAIYFSRGLIPYNKSGKVNPQFPYLLHLGIQSYDSNFLKIYPGLHPTPLQLEEDLEQLKVLENGYKMKVIKVDHEAHGVDAPEDVEKIESFMRERNLS
cEEEEEccccccEEEEcccHHHHHHHHHccccEEEcccccccccHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHcccccEEEccccccccccccccccEEEEcccccEEEEccccccccccccccccccccccEEEEEccHHHHHHcccccccccHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHHcccc
MLVMCHSFLFCGLVVATDDEKIAECCQQFGADVIMTSESCRNGTERCNEALQKLEKKYDIVVNIQGDEPLIEPEIIDGVVKALQAAPDAVFSTAVTSLKPEDAFDPNRVKCVVDNHGYAIYFSRGLIPYNKSGKVNPQFPYLLHLGIQSYDSNFLKIYPGLHPTPLQLEEDLEQLKVLENGYKMKVIKVDHEAHGVDAPEDVEKIESFMRER***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVMCHSFLFCGLVVATDDEKIAECCQQFGADVIMTSESCRNGTERCNEALQKLEKKYDIVVNIQGDEPLIEPEIIDGVVKALQAAPDAVFSTAVTSLKPEDAFDPNRVKCVVDNHGYAIYFSRGLIPYNKSGKVNPQFPYLLHLGIQSYDSNFLKIYPGLHPTPLQLEEDLEQLKVLENGYKMKVIKVDHEAHGVDAPEDVEKIESFMRERNLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial Catalyzes the production of the sugar nucleotide CMP-3-deoxy-D-manno-octulosonate (CMP-KDO). CTP is the preferred nucleotide donor, but it can partially be replaced with UTP. Activates KDO during the biosynthesis of rhamnogalacturonan II (RG-II), a structurally complex pectic polysaccharide of the primary cell wall. RG-II is essential for the cell wall integrity of rapidly growing tissues and pollen tube growth and elongation.probableQ9C920
3-deoxy-manno-octulosonate cytidylyltransferase Activates KDO (a required 8-carbon sugar) for incorporation into bacterial lipopolysaccharide in Gram-negative bacteria.probableB8FKL0
3-deoxy-manno-octulosonate cytidylyltransferase Activates KDO (a required 8-carbon sugar) for incorporation into bacterial lipopolysaccharide in Gram-negative bacteria.probableQ04VK9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.383-deoxy-manno-octulosonate cytidylyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FCU, chain A
Confidence level:very confident
Coverage over the Query: 4-212
View the alignment between query and template
View the model in PyMOL