Citrus Sinensis ID: 028063

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----

MSDEMGASVPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISGVPQLLSKFSFNIIAS

cccccccccccccccccccEEEEEEcccCECcccccccccccHHHHHHHHHHHHHHHcccEEEEEEEEEEEEccccEEEEEEEcccEEEcccccccccccHHHHHHHHHHHHcccccccccccCEEEEEEEEECccccccccccccccccccccCEEEEEEEEccccEEEECccccEEEEcccHHHHccccccccEEEccccEEEEEEEEEEcc

****************NGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISGVPQLLSKFSFNIIAS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cleavage and polyadenylation specificity factor subunit 5	Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export.	probable	Q5RAI8
Cleavage and polyadenylation specificity factor subunit 5	Mediates sequence-specific recognition of 5'-UGUA-3' elements within the pre-mRNA. Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing.	probable	Q7T3C6
Cleavage and polyadenylation specificity factor subunit 5	Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export.	probable	Q3ZCA2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BHO, chain A
Confidence level:very confident
Coverage over the Query: 12-212
View the alignment between query and template
View the model in PyMOL