Citrus Sinensis ID: 028063

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MSDEMGASVPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISGVPQLLSKFSFNIIAS
cccccccccccccccccccEEEEEEcccEEEccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEccccEEEEEEEcccEEEcccccccccccHHHHHHHHHHHHcccccccccccEEEEEEEEEEEccccccccccccccccccccEEEEEEEEEccccEEEEEccccEEEEcccHHHHccccccccEEEccccEEEEEEEEEEcc
cccccccccccccccccccEEEEEEccccEcccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEEcccEEEcccccccccccHHHHHHHHHHHHccccccccccccEHHHHHHHHccccccccccccccccccccccEEEEEEEEccccEEEEcccccEEEEEEHHHHHcccccccHHHHHHHHHHHHccEEEEcc
msdemgasvpingsdrngyvvdiyplssyyfgskeaipfkdetLYNRVLRMKsnydahglRTCVEAVLLVELFKHPHLLLLQVRNSIfklpggrlrpgesdiygLKRKLTRKLslnedggevdwEVGEClgmwwkpdfetllfpyfppnvkrpkecTKLFLVKlpvsqkffvpknlkllavplcqihenhktygqiisgvpqllskfsfniias
msdemgasvpingsdrngyVVDIYPLSSYyfgskeaipfkDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIfklpggrlrpgesdiyglkrkltrklslnedggevDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISGVPQLLSKFSFNIIAS
MSDEMGASVPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNedggevdwevgeCLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISGVPQLLSKFSFNIIAS
****************NGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISGVPQLLSKFSFNII**
*******************VVDIYPLSSYYFGSKEAI*****TLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISGVPQLLSKFSFNIIAS
********VPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISGVPQLLSKFSFNIIAS
****************NGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISGVPQLLSKFSFNIIAS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDEMGASVPINGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISGVPQLLSKFSFNIIAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
Q6DJE4227 Cleavage and polyadenylat N/A no 0.883 0.832 0.468 8e-47
Q5RAI8227 Cleavage and polyadenylat yes no 0.883 0.832 0.468 3e-46
O43809227 Cleavage and polyadenylat yes no 0.883 0.832 0.468 3e-46
Q3ZCA2227 Cleavage and polyadenylat yes no 0.883 0.832 0.468 3e-46
Q4KM65227 Cleavage and polyadenylat yes no 0.883 0.832 0.468 3e-46
Q9CQF3227 Cleavage and polyadenylat yes no 0.883 0.832 0.468 3e-46
Q7T3C6228 Cleavage and polyadenylat yes no 0.883 0.828 0.463 3e-46
Q55E68200 Cleavage and polyadenylat yes no 0.845 0.905 0.461 4e-42
>sp|Q6DJE4|CPSF5_XENLA Cleavage and polyadenylation specificity factor subunit 5 OS=Xenopus laevis GN=cpsf5 PE=2 SV=1 Back     alignment and function desciption
 Score =  186 bits (473), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 129/190 (67%), Gaps = 1/190 (0%)

Query: 20  VVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLL 79
            +++YPL++Y FG+KE +  KD ++  R  RM+  +D  G+R  VE VL+V   + PH+L
Sbjct: 36  TINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVL 95

Query: 80  LLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFE 139
           LLQ+  + FKLPGG L PGE ++ GLKR +T  L   +DG + DW + +C+G WW+P+FE
Sbjct: 96  LLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILG-RQDGVQQDWVIDDCIGNWWRPNFE 154

Query: 140 TLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISG 199
              +PY P ++ +PKE  KLFLV+L     F VPKN KL+A PL ++++N   YG IIS 
Sbjct: 155 PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISS 214

Query: 200 VPQLLSKFSF 209
           +PQLLS+F+F
Sbjct: 215 LPQLLSRFNF 224
Mediates sequence-specific recognition of 5'-UGUA-3' elements within the pre-mRNA. Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing.
Xenopus laevis (taxid: 8355)
>sp|Q5RAI8|CPSF5_PONAB Cleavage and polyadenylation specificity factor subunit 5 OS=Pongo abelii GN=NUDT21 PE=2 SV=1 Back     alignment and function description
>sp|O43809|CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens GN=NUDT21 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZCA2|CPSF5_BOVIN Cleavage and polyadenylation specificity factor subunit 5 OS=Bos taurus GN=NUDT21 PE=2 SV=1 Back     alignment and function description
>sp|Q4KM65|CPSF5_RAT Cleavage and polyadenylation specificity factor subunit 5 OS=Rattus norvegicus GN=Nudt21 PE=2 SV=1 Back     alignment and function description
>sp|Q9CQF3|CPSF5_MOUSE Cleavage and polyadenylation specificity factor subunit 5 OS=Mus musculus GN=Nudt21 PE=2 SV=1 Back     alignment and function description
>sp|Q7T3C6|CPSF5_DANRE Cleavage and polyadenylation specificity factor subunit 5 OS=Danio rerio GN=cpsf5 PE=2 SV=1 Back     alignment and function description
>sp|Q55E68|CPSF5_DICDI Cleavage and polyadenylation specificity factor subunit 5 OS=Dictyostelium discoideum GN=cpsf5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
255546065214 pre-mRNA cleavage factor im, 25kD subuni 0.934 0.934 0.792 6e-89
297738624291 unnamed protein product [Vitis vinifera] 1.0 0.735 0.746 2e-87
225444838284 PREDICTED: cleavage and polyadenylation 1.0 0.753 0.746 2e-87
449446606217 PREDICTED: cleavage and polyadenylation 0.906 0.894 0.798 2e-86
18417474222 CFIM-25-like protein [Arabidopsis thalia 0.939 0.905 0.731 3e-84
363807126216 uncharacterized protein LOC100791216 [Gl 0.887 0.879 0.768 5e-84
224087967210 predicted protein [Populus trichocarpa] 0.925 0.942 0.746 6e-84
297799004223 hypothetical protein ARALYDRAFT_491776 [ 0.976 0.937 0.685 9e-81
356558387233 PREDICTED: LOW QUALITY PROTEIN: cleavage 0.887 0.815 0.747 1e-78
388493122205 unknown [Medicago truncatula] 0.873 0.912 0.747 2e-78
>gi|255546065|ref|XP_002514092.1| pre-mRNA cleavage factor im, 25kD subunit, putative [Ricinus communis] gi|223546548|gb|EEF48046.1| pre-mRNA cleavage factor im, 25kD subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  332 bits (851), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 179/202 (88%), Gaps = 2/202 (0%)

Query: 13  GSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVEL 72
            S   G+V+DIYPLS YYFGSK+ +PF+DETL +RV RMKSNY AHGLRTCVEAV+LVEL
Sbjct: 15  ASRDQGFVLDIYPLSRYYFGSKDPLPFRDETLVDRVQRMKSNYLAHGLRTCVEAVILVEL 74

Query: 73  FKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGM 132
           FKHPHLLLLQ++NSIFKLPGGR+RPGESDI GLKRKL+RKLS N+D  + DWEVGECLGM
Sbjct: 75  FKHPHLLLLQIKNSIFKLPGGRIRPGESDIGGLKRKLSRKLSNNQD--QTDWEVGECLGM 132

Query: 133 WWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKT 192
           WW+PDFETLL+PY PPN+K PKECTKLFLV+LP S KF VPKNLKLLAVPL QIH+NHKT
Sbjct: 133 WWRPDFETLLYPYLPPNLKTPKECTKLFLVRLPTSCKFIVPKNLKLLAVPLSQIHDNHKT 192

Query: 193 YGQIISGVPQLLSKFSFNIIAS 214
           YG IISGVPQLLSK+SF II S
Sbjct: 193 YGGIISGVPQLLSKYSFRIINS 214

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297738624|emb|CBI27869.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225444838|ref|XP_002279095.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449446606|ref|XP_004141062.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Cucumis sativus] gi|449488056|ref|XP_004157928.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18417474|ref|NP_567835.1| CFIM-25-like protein [Arabidopsis thaliana] gi|15081674|gb|AAK82492.1| AT4g29820/F27B13_60 [Arabidopsis thaliana] gi|20147173|gb|AAM10303.1| AT4g29820/F27B13_60 [Arabidopsis thaliana] gi|21554114|gb|AAM63194.1| mRNA cleavage factor subunit-like protein [Arabidopsis thaliana] gi|332660282|gb|AEE85682.1| CFIM-25-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|363807126|ref|NP_001242595.1| uncharacterized protein LOC100791216 [Glycine max] gi|255640824|gb|ACU20695.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224087967|ref|XP_002308275.1| predicted protein [Populus trichocarpa] gi|222854251|gb|EEE91798.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297799004|ref|XP_002867386.1| hypothetical protein ARALYDRAFT_491776 [Arabidopsis lyrata subsp. lyrata] gi|297313222|gb|EFH43645.1| hypothetical protein ARALYDRAFT_491776 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356558387|ref|XP_003547488.1| PREDICTED: LOW QUALITY PROTEIN: cleavage and polyadenylation specificity factor subunit 5-like [Glycine max] Back     alignment and taxonomy information
>gi|388493122|gb|AFK34627.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
TAIR|locus:2123919222 CFIM-25 "homolog of CFIM-25" [ 0.901 0.869 0.725 3.1e-76
TAIR|locus:2131839200 AT4G25550 [Arabidopsis thalian 0.911 0.975 0.512 3.5e-52
UNIPROTKB|Q3ZCA2227 NUDT21 "Cleavage and polyadeny 0.878 0.828 0.449 2.8e-41
UNIPROTKB|E2QUJ4227 NUDT21 "Uncharacterized protei 0.878 0.828 0.449 2.8e-41
UNIPROTKB|O43809227 NUDT21 "Cleavage and polyadeny 0.878 0.828 0.449 2.8e-41
UNIPROTKB|Q5RAI8227 NUDT21 "Cleavage and polyadeny 0.878 0.828 0.449 2.8e-41
UNIPROTKB|Q6DJE4227 cpsf5 "Cleavage and polyadenyl 0.878 0.828 0.449 2.8e-41
MGI|MGI:1915469227 Nudt21 "nudix (nucleoside diph 0.878 0.828 0.449 2.8e-41
RGD|1305766227 Nudt21 "nudix (nucleoside diph 0.878 0.828 0.449 2.8e-41
UNIPROTKB|E2R7S0234 LOC100684233 "Uncharacterized 0.878 0.803 0.449 4.6e-41
TAIR|locus:2123919 CFIM-25 "homolog of CFIM-25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 768 (275.4 bits), Expect = 3.1e-76, P = 3.1e-76
 Identities = 140/193 (72%), Positives = 164/193 (84%)

Query:    20 VVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLL 79
             +VD+YPLSSYYFGSKEA+  KDE + +RV+R+KSNY AHGLRTCVEAVLLVELFKHPH+L
Sbjct:    28 MVDLYPLSSYYFGSKEALRVKDEIISDRVIRLKSNYAAHGLRTCVEAVLLVELFKHPHVL 87

Query:    80 LLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNXXXXXXXXXXXXCLGMWWKPDFE 139
             LLQ RNSIFKLPGGRLRPGESDI GLKRKL  KLS+N            C+GMWW+P+FE
Sbjct:    88 LLQYRNSIFKLPGGRLRPGESDIEGLKRKLASKLSVNENVGVSGYEVGECIGMWWRPNFE 147

Query:   140 TLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISG 199
             TL++P+ PPN+K PKECTKLFLV+LPV Q+F VPKN KLLAVPLCQ+HEN KTYG I+S 
Sbjct:   148 TLMYPFLPPNIKHPKECTKLFLVRLPVHQQFVVPKNFKLLAVPLCQLHENEKTYGPIMSQ 207

Query:   200 VPQLLSKFSFNII 212
             +P+LLSKFSFN++
Sbjct:   208 IPKLLSKFSFNMM 220
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0010260 "organ senescence" evidence=RCA
TAIR|locus:2131839 AT4G25550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCA2 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUJ4 NUDT21 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43809 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAI8 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DJE4 cpsf5 "Cleavage and polyadenylation specificity factor subunit 5" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:1915469 Nudt21 "nudix (nucleoside diphosphate linked moiety X)-type motif 21" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305766 Nudt21 "nudix (nucleoside diphosphate linked moiety X)-type motif 21" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R7S0 LOC100684233 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5RAI8CPSF5_PONABNo assigned EC number0.46840.88310.8325yesno
Q7T3C6CPSF5_DANRENo assigned EC number0.46310.88310.8289yesno
Q3ZCA2CPSF5_BOVINNo assigned EC number0.46840.88310.8325yesno
Q9CQF3CPSF5_MOUSENo assigned EC number0.46840.88310.8325yesno
Q4KM65CPSF5_RATNo assigned EC number0.46840.88310.8325yesno
Q55E68CPSF5_DICDINo assigned EC number0.46190.84570.905yesno
O43809CPSF5_HUMANNo assigned EC number0.46840.88310.8325yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
pfam13869188 pfam13869, NUDIX_2, Nucleotide hydrolase 1e-106
cd04686131 cd04686, Nudix_Hydrolase_27, Members of the Nudix 8e-04
cd04690118 cd04690, Nudix_Hydrolase_31, Members of the Nudix 0.002
>gnl|CDD|206040 pfam13869, NUDIX_2, Nucleotide hydrolase Back     alignment and domain information 
 Score =  301 bits (774), Expect = e-106
 Identities = 113/188 (60%), Positives = 147/188 (78%), Gaps = 1/188 (0%)

Query: 20  VVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLL 79
           V+D+YPLS+Y FG+KEA+  KD ++  R+ R+K+NY+ +G+R  VE VLLV    HPH+L
Sbjct: 2   VIDLYPLSNYTFGTKEALVEKDISVAERLKRLKNNYEKNGMRRSVEGVLLVHRHGHPHVL 61

Query: 80  LLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFE 139
           LLQ+ N+ FKLPGGRLRPGE +I GLKRKL +KLS  EDG E DWEVGECLG WW+P+FE
Sbjct: 62  LLQIGNTFFKLPGGRLRPGEDEIEGLKRKLAKKLS-PEDGVEEDWEVGECLGEWWRPNFE 120

Query: 140 TLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISG 199
           T ++PY P ++ +PKEC KL+LV+LP   KF VPKN+KLLAVPL ++++N   YG IIS 
Sbjct: 121 TSMYPYLPAHITKPKECIKLYLVQLPEKCKFAVPKNMKLLAVPLFELYDNAAKYGPIISS 180

Query: 200 VPQLLSKF 207
           +P LLS+F
Sbjct: 181 LPHLLSRF 188

Nudix hydrolases are found in all classes of organism and hydrolyse a wide range of organic pyrophosphates, including nucleoside di- and triphosphates, di-nucleoside and diphospho-inositol polyphosphates, nucleotide sugars and RNA caps, with varying degrees of substrate specificity. Length = 188
>gnl|CDD|240042 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240046 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
KOG1689221 consensus mRNA cleavage factor I subunit [RNA proc 100.0
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 100.0
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.19
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.12
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.1
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.09
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.09
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.08
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.07
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.05
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.02
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.02
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.02
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.0
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.0
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 98.98
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 98.98
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 98.98
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 98.96
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 98.95
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 98.94
PLN02325144 nudix hydrolase 98.94
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 98.94
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 98.93
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 98.93
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 98.92
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 98.92
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 98.91
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 98.9
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 98.89
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 98.85
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 98.85
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 98.85
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 98.85
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 98.83
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 98.83
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 98.81
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 98.81
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 98.81
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 98.8
PLN02709222 nudix hydrolase 98.8
PRK10707190 putative NUDIX hydrolase; Provisional 98.79
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 98.79
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 98.78
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 98.77
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 98.77
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 98.76
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 98.74
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 98.74
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 98.74
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 98.74
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 98.72
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 98.7
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 98.69
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 98.66
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 98.65
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 98.64
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 98.64
PRK00714156 RNA pyrophosphohydrolase; Reviewed 98.61
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 98.61
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 98.6
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 98.59
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 98.56
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 98.55
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 98.54
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 98.51
PRK15393180 NUDIX hydrolase YfcD; Provisional 98.51
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 98.5
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 98.48
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 98.43
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 98.35
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 98.33
PRK08999 312 hypothetical protein; Provisional 98.3
PRK00241256 nudC NADH pyrophosphatase; Reviewed 98.17
KOG2839145 consensus Diadenosine and diphosphoinositol polyph 98.07
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 98.06
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 98.05
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 98.02
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 97.85
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 97.8
PLN03143291 nudix hydrolase; Provisional 97.65
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 97.3
KOG3069246 consensus Peroxisomal NUDIX hydrolase [Replication 96.92
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 96.88
PLN02791 770 Nudix hydrolase homolog 96.73
KOG0648295 consensus Predicted NUDIX hydrolase FGF-2 and rela 96.59
KOG3084345 consensus NADH pyrophosphatase I of the Nudix fami 96.33
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 95.99
KOG3041225 consensus Nucleoside diphosphate-sugar hydrolase o 95.8
KOG4195275 consensus Transient receptor potential-related cha 95.79
PLN02552247 isopentenyl-diphosphate delta-isomerase 95.67
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 91.99
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 88.72
PLN02839372 nudix hydrolase 87.93
>KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=9.3e-97  Score=620.11  Aligned_cols=195  Identities=56%  Similarity=1.005  Sum_probs=191.6

Q ss_pred             ceEEEeeCCceeeccccCCCCCChhHHHHHHHHHHhhcccCCeeEEEEEEEEecCCCCeEEEEeecCCceecCCcccCCC
Q 028063           19 YVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPG   98 (214)
Q Consensus        19 ~~~~~Ypl~nY~fg~k~~~~ekd~sv~~rl~Rl~~~y~~~GmRrsV~aVllvh~h~~phVLLLQ~~~~~fkLPGGrl~~g   98 (214)
                      ++|++||||||+|||||++.|||+||++||+||+++|++.||||||+||++||+|++|||||||++|+|||||||+|+||
T Consensus        27 ~~vn~YPLsnYtFGtKe~~~eKD~svadrf~rmk~ey~k~gmRrsvegvlivheH~lPHvLLLQig~tf~KLPGG~L~pG  106 (221)
T KOG1689|consen   27 RTVNLYPLSNYTFGTKEALREKDESVADRFARMKIEYMKEGMRRSVEGVLIVHEHNLPHVLLLQIGNTFFKLPGGRLRPG  106 (221)
T ss_pred             heeeeeecccccccccchhhhccchHHHHHHHHHHHHHhhhhhheeeeeEEEeecCCCeEEEEeeCCEEEecCCCccCCC
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CChHHHHHHHHHhhhCCCCCCCCcceEEceeeeeeecCCCCCCCCCCCCCCCCCcceeeEEEEEEcCCceEEeecCCCeE
Q 028063           99 ESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKL  178 (214)
Q Consensus        99 E~e~egLkReL~EeLg~~~~~~~~~~eVge~Lg~WwRpnFe~~~yPYlP~Hit~pKE~~kl~~V~Lpe~~~f~vpkn~kL  178 (214)
                      |+|++||+|.|+|.||. .++...+|.||||+|+|||||||+.|||||||||||||||+|||+||||++..|+||||+||
T Consensus       107 E~e~~Gl~r~l~~~Lgr-~dg~~~dwtv~ecig~WWRPNFe~~~YPyiP~hitkPKeh~kL~lV~L~~k~~F~VPKN~KL  185 (221)
T KOG1689|consen  107 EDEADGLKRLLTESLGR-SDGLVIDWTVGECIGNWWRPNFETPMYPYIPPHITKPKEHTKLFLVQLPEKQQFAVPKNFKL  185 (221)
T ss_pred             cchhHHHHHHHHHHhcc-cccccccccHhhhhhcccCCCCCCcccCCCCcccCCchhccEEEEEEccccceEeccCCcee
Confidence            99999999999999995 57888999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeccchhhhcCcccccceeecccceeeeeEEEEecC
Q 028063          179 LAVPLCQIHENHKTYGQIISGVPQLLSKFSFNIIAS  214 (214)
Q Consensus       179 ~AvPLfely~N~~~yG~~is~iP~llSRf~f~~~~~  214 (214)
                      +||||||||||++.||||||+||++||||||+|+.+
T Consensus       186 lA~PLfeLydN~~~yGPiiSslp~~lsrFnFi~n~~  221 (221)
T KOG1689|consen  186 LAVPLFELYDNAKTYGPIISSLPKLLSRFNFIMNEI  221 (221)
T ss_pred             eeeeHhhhhhccccccchhHHHHHHHhhhceeeccC
Confidence            999999999999999999999999999999999864

>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
2j8q_A227 Crystal Structure Of Human Cleavage And Polyadenyla 3e-43
2cl3_A230 Crystal Structure Of Human Cleavage And Polyadenyla 3e-43
3mdg_A227 Crystal Structure Of The 25kda Subunit Of Human Cle 3e-43
3p5t_A202 Cfim25-Cfim68 Complex Length = 202 4e-43
3q2s_A207 Crystal Structure Of Cfim68 RrmCFIM25 COMPLEX Lengt 4e-43
3bho_A208 Crystal Structure Of The 25kda Subunit Of Human Cle 4e-43
3bap_A227 Crystal Structure Of The 25 Kda Subunit Of Human Cl 1e-41
>pdb|2J8Q|A Chain A, Crystal Structure Of Human Cleavage And Polyadenylation Specificity Factor 5 (Cpsf5) In Complex With A Sulphate Ion. Length = 227 Back     alignment and structure 
Iteration: 1

 Score =  171 bits (433), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/190 (44%), Positives = 121/190 (63%), Gaps = 1/190 (0%)
Query: 20  VVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLL 79
            +++YPL++Y FG+KE +  KD ++  R  RM+  +D  G+R  VE VL+V   + PH+L
Sbjct: 36  TINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVL 95
Query: 80  LLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNXXXXXXXXXXXXCLGMWWKPDFE 139
           LLQ+  + FKLPGG L PGE ++ GLKR +T  L               C+G WW+P+FE
Sbjct: 96  LLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILG-RQDGVLQDWVIDDCIGNWWRPNFE 154
Query: 140 TLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISG 199
              +PY P ++ +PKE  KLFLV+L     F VPKN KL+A PL ++++N   YG IIS 
Sbjct: 155 PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISS 214
Query: 200 VPQLLSKFSF 209
           +PQLLS+F+F
Sbjct: 215 LPQLLSRFNF 224
>pdb|2CL3|A Chain A, Crystal Structure Of Human Cleavage And Polyadenylation Specificity Factor 5 (Cpsf5) Length = 230 Back     alignment and structure
>pdb|3MDG|A Chain A, Crystal Structure Of The 25kda Subunit Of Human Cleavage Factor Im In Complex With Rna Uuguau Length = 227 Back     alignment and structure
>pdb|3P5T|A Chain A, Cfim25-Cfim68 Complex Length = 202 Back     alignment and structure
>pdb|3Q2S|A Chain A, Crystal Structure Of Cfim68 RrmCFIM25 COMPLEX Length = 207 Back     alignment and structure
>pdb|3BHO|A Chain A, Crystal Structure Of The 25kda Subunit Of Human Cleavage Factor Im With Ap4a Length = 208 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
3bho_A208 Cleavage and polyadenylation specificity factor su 1e-91
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Length = 208 Back     alignment and structure
 Score =  266 bits (682), Expect = 1e-91
 Identities = 89/192 (46%), Positives = 128/192 (66%), Gaps = 1/192 (0%)

Query: 20  VVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLL 79
            +++YPL++Y FG+KE +  KD ++  R  RM+  +D  G+R  VE VL+V   + PH+L
Sbjct: 17  TINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVL 76

Query: 80  LLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFE 139
           LLQ+  + FKLPGG L PGE ++ GLKR +T  L   +DG   DW + +C+G WW+P+FE
Sbjct: 77  LLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILG-RQDGVLQDWVIDDCIGNWWRPNFE 135

Query: 140 TLLFPYFPPNVKRPKECTKLFLVKLPVSQKFFVPKNLKLLAVPLCQIHENHKTYGQIISG 199
              +PY P ++ +PKE  KLFLV+L     F VPKN KL+A PL ++++N   YG IIS 
Sbjct: 136 PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISS 195

Query: 200 VPQLLSKFSFNI 211
           +PQLLS+F+F  
Sbjct: 196 LPQLLSRFNFIY 207

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
3bho_A208 Cleavage and polyadenylation specificity factor su 100.0
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.3
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.16
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.14
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.13
3f13_A163 Putative nudix hydrolase family member; structural 99.08
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.08
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.08
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.05
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.04
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.04
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.03
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.03
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.02
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.02
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.01
2fb1_A226 Conserved hypothetical protein; structural genomic 99.01
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.01
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.0
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 98.99
3grn_A153 MUTT related protein; structural genomics, hydrola 98.98
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 98.98
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 98.95
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 98.94
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 98.94
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 98.93
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 98.93
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 98.93
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 98.92
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 98.92
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 98.92
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 98.92
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 98.91
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 98.9
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 98.9
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 98.89
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 98.89
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 98.88
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 98.87
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 98.86
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 98.86
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 98.85
2fml_A273 MUTT/nudix family protein; structural genomics, PS 98.84
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 98.83
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 98.82
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 98.81
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 98.81
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 98.8
3fcm_A197 Hydrolase, nudix family; protein structure initiat 98.79
3exq_A161 Nudix family hydrolase; protein structure initiati 98.77
2b06_A155 MUTT/nudix family protein; structural genomics, P 98.77
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 98.76
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 98.76
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 98.7
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 98.68
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 98.67
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 98.66
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 98.6
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 98.6
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 98.58
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 98.56
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 98.55
3e57_A211 Uncharacterized protein TM1382; structural genomic 98.55
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 98.55
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 98.55
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 98.51
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 98.45
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 98.4
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 98.39
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 98.37
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 98.2
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 98.08
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 98.06
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 97.84
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 97.76
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 97.5
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 97.35
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
Probab=100.00  E-value=1.2e-93  Score=614.35  Aligned_cols=200  Identities=45%  Similarity=0.838  Sum_probs=189.9

Q ss_pred             CCCCCCCceEEEeeCCceeeccccCCCCCChhHHHHHHHHHHhhcccCCeeEEEEEEEEecCCCCeEEEEeecCCceecC
Q 028063           12 NGSDRNGYVVDIYPLSSYYFGSKEAIPFKDETLYNRVLRMKSNYDAHGLRTCVEAVLLVELFKHPHLLLLQVRNSIFKLP   91 (214)
Q Consensus        12 ~~~~~~~~~~~~Ypl~nY~fg~k~~~~ekd~sv~~rl~Rl~~~y~~~GmRrsV~aVllvh~h~~phVLLLQ~~~~~fkLP   91 (214)
                      +.++...++|+||||+||+||+||+++|||+|+.+||+||+++|++.|||++|+|||+||+|++|||||+|+++++|+||
T Consensus         9 ~~~~~~~~~~~iYplsnY~f~~k~~~~ekd~s~~~r~~rl~~~y~~~g~R~sV~avil~~~~~~phVLLlq~~~~~f~LP   88 (208)
T 3bho_A            9 TKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLP   88 (208)
T ss_dssp             CCCTTTCCEEEECBGGGEEEEEECCCCCSCSSHHHHHHHHHHHHHHHCSEEEEEEEEEEEETTEEEEEEEEEETTEEECS
T ss_pred             CCCccccceEEEecccceeEccCCccccccccHHHHHHHHHHHHHhhCCceEEEEEEEEcCCCCcEEEEEEcCCCcEECC
Confidence            45666678999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccCCCCChHHHHHHHHHhhhCCCCCCCCcceEEceeeeeeecCCCCCCCCCCCCCCCCCcceeeEEEEEEcCCceEEe
Q 028063           92 GGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGMWWKPDFETLLFPYFPPNVKRPKECTKLFLVKLPVSQKFF  171 (214)
Q Consensus        92 GGrl~~gE~e~egLkReL~EeLg~~~~~~~~~~eVge~Lg~WwRpnFe~~~yPYlP~Hit~pKE~~kl~~V~Lpe~~~f~  171 (214)
                      ||++++||++++||+|||.|+||. ++++..+|+||||||+|||||||++||||+||||||||||+|||+|||||+|+|+
T Consensus        89 GGkle~gE~~~eaL~REL~EELg~-~~~~~~~~eIge~lg~wwRp~fet~~YPYlP~Hit~pKE~~kly~V~Lp~~~~f~  167 (208)
T 3bho_A           89 GGELNPGEDEVEGLKRLMTEILGR-QDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFA  167 (208)
T ss_dssp             EEECCTTCCHHHHHHHHHHHHHCC-CC-----CEEEEEEEEEEECSSSSCCBSSCCTTCCSCSEEEEEEEEECCSSEEEE
T ss_pred             CcccCCCCCHHHHHHHHHHHHhCC-CcCCCccEEEhheEEEEecCCCCCcCCCCCCcccCchhhheeeeeEecCccceEe
Confidence            999999999999999999999998 4667789999999999999999999999999999999999999999999999999


Q ss_pred             ecCCCeEEeccchhhhcCcccccceeecccceeeeeEEEEe
Q 028063          172 VPKNLKLLAVPLCQIHENHKTYGQIISGVPQLLSKFSFNII  212 (214)
Q Consensus       172 vpkn~kL~AvPLfely~N~~~yG~~is~iP~llSRf~f~~~  212 (214)
                      |||||||+||||||||||+++|||+||||||+||||+|+|+
T Consensus       168 vPkn~kL~AvPLfely~N~~~yG~~issiP~llSRf~~~~~  208 (208)
T 3bho_A          168 VPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN  208 (208)
T ss_dssp             EETTCEEEEEEHHHHTTCHHHHHHHHTTHHHHHTTCEEEEC
T ss_pred             cCCCCeEEeecHHhhhcchhhhchhhhhhhhhhhheeeEeC
Confidence            99999999999999999999999999999999999999985
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 214
d2fvva1135 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat 0.003
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Diphosphoinositol polyphosphate phosphohydrolase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 34.3 bits (78), Expect = 0.003
 Identities = 18/95 (18%), Positives = 36/95 (37%), Gaps = 10/95 (10%)

Query: 55  YDAHGLRTCVEAVLLVELFKHPHLLLLQVRNS-IFKLPGGRLRPGESDIYGLKRKLTRKL 113
           YD  G +     +      +   LL+   R+   + +PGG + P E       R+     
Sbjct: 5   YDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVRE----- 59

Query: 114 SLNEDGGEVDWEVGECLGMW--WKPDFETLLFPYF 146
            + E+ G V   +G  +G++   +    T ++   
Sbjct: 60  -VCEEAG-VKGTLGRLVGIFENQERKHRTYVYVLI 92

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.25
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.2
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.13
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.12
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.11
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.1
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.1
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.03
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.02
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.01
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.01
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.0
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 98.99
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 98.98
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 98.95
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 98.95
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 98.91
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 98.79
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 98.7
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 98.64
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 98.63
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 98.52
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 98.51
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 98.42
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 98.39
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 98.23
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 97.95
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 97.92
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 97.22
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 97.11
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: AP6A hydrolase Ndx1
species: Thermus thermophilus [TaxId: 274]

Probab=99.25  E-value=1.1e-11  Score=93.53  Aligned_cols=63  Identities=24%  Similarity=0.218  Sum_probs=54.9

Q ss_pred             CeeEEEEEEEEecCCCCeEEEEeecCCceecCCcccCCCCChHHHHHHHHHhhhCCCCCCCCcceEEceeeee
Q 028063           60 LRTCVEAVLLVELFKHPHLLLLQVRNSIFKLPGGRLRPGESDIYGLKRKLTRKLSLNEDGGEVDWEVGECLGM  132 (214)
Q Consensus        60 mRrsV~aVllvh~h~~phVLLLQ~~~~~fkLPGGrl~~gE~e~egLkReL~EeLg~~~~~~~~~~eVge~Lg~  132 (214)
                      |+.+|-|||+   ++.-.|||+|+..+.|.||||++++||+..+|++||+.||+|.       +.++.+.++.
T Consensus         1 ~~v~agavv~---~~~~~vLl~~~~~g~w~~PgG~ve~gEt~~~aa~RE~~EEtGi-------~~~~~~~~~~   63 (126)
T d1vcda1           1 MELGAGGVVF---NAKREVLLLRDRMGFWVFPKGHPEPGESLEEAAVREVWEETGV-------RAEVLLPLYP   63 (126)
T ss_dssp             CEEEEEEEEE---CTTSCEEEEECTTSCEECCEECCCTTCCHHHHHHHHHHHHHCC-------EEEEEEEEEE
T ss_pred             CEEEEEEEEE---ECCCEEEEEEcCCCCEECCccccCCCCCHHHHHHHHHHHHcCC-------eeEEEEEEee
Confidence            7888999987   3344899999999999999999999999999999999999998       5666677765
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure