Citrus Sinensis ID: 028067


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MMVTNDYITVNGSGSGGFGKIEEDYIKRHHKHDVHDHQCSSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCIVQGDLQIGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLKIIWNFSNFISTSSSKLQNYSSIVTVHPEVIDGRPGTLVIESFVVDVPDGNTKDETCYFVEALIKCNLKSLADVSEHLAVQDRTEPIDRI
cEEEccEEEECcccccccccccHHHHHHHccccccccccCEEEEEEEccccccHHHHHHccccccccccccEEEEEEccccccEEEEEEEECcccccccccccccccccccEEEEEEEcccccEEEEEcccccccccccccccccccEEEECcccccccEEEEEEEEEEEccccccccHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccc
******YITVNGSGSGGFGKIEEDYIKRHHKHDVHDHQCSSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCIVQGDLQIGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLKIIWNFSNFISTSSSKLQNYSSIVTVHPEVIDGRPGTLVIESFVVDVPDGNTKDETCYFVEALIKCNLKSLADVSEH*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVTNDYITVNGSGSGGFGKIEEDYIKRHHKHDVHDHQCSSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCIVQGDLQIGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLKIIWNFSNFISTSSSKLQNYSSIVTVHPEVIDGRPGTLVIESFVVDVPDGNTKDETCYFVEALIKCNLKSLADVSEHLAVQDRTEPIDRI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Abscisic acid receptor PYL8 Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition. Inhibits the activity of group-A protein phosphatases type 2C (PP2Cs) when activated by ABA. Confers enhanced sensitivity to ABA.probableQ9FGM1
Abscisic acid receptor PYL9 Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition. Inhibits the activity of group-A protein phosphatases type 2C (PP2Cs) when activated by ABA. Confers enhanced sensitivity to ABA.probableQ84MC7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OQU, chain A
Confidence level:very confident
Coverage over the Query: 23-121,139-206
View the alignment between query and template
View the model in PyMOL