Citrus Sinensis ID: 028110

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---

MKVDNPSKHKIQQQEEEEEEAEQMCRTIEVASVVDLSPQPAPVVTGDEVTLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFDISSLKHLPMSFSCLKR

cccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccEEccccccccHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccc

ccccccccccHHHHHHHHcccHHHccccEcccccccccccccccccccccccccccccccccccEcccccccccHHHHHHccccEEEEEccccccHHHHHHHHHcccEEEEEEccccccccccccHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHcccccccccc

mkvdnpskhkiQQQEEEEEEAEQMCRTIEVASvvdlspqpapvvtgdevtlipplnfsmvdngifrsgfpdsanfsfLQTLRLRSIIylcpepypeantEFLKSNGIKLFQFAIeghkepfvnipEDMIREALKVLLDvrnhpvlihckrgkhrtgclVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELfdisslkhlpmsfsclkr

mkvdnpskhkiqqqeeEEEEAEQMCRTIEVASVVDLSPQPAPVVTGDEVTLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDMIREALKVLLDVRNhpvlihckrgkhrtgCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELfdisslkhlpmsfsclkr

MKVDNPSKHKIqqqeeeeeeaeqMCRTIEVASVVDLSPQPAPVVTGDEVTLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFDISSLKHLPMSFSCLKR

*************************RTIEVASVVDLSPQPAPVVTGDEVTLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFDISSLKHLP********

*************************************************TLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFDISSLKHLPMSFSC***

************************CRTIEVASVVDLSPQPAPVVTGDEVTLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFDISSLKHLPMSFSCLKR

****************************EV*****************EVTLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFDISSLKHLPM*******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKVDNPSKHKxxxxxxxxxxxxxxxxxxxxxSVVDLSPQPAPVVTGDEVTLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFDISSLKHLPMSFSCLKR

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		213	2.2.26 [Sep-21-2011]
Q9ZVN4		215	Probable tyrosine-protein	yes	no	0.924	0.916	0.756	2e-87
P53965		281	Tyrosine-protein phosphat	yes	no	0.943	0.715	0.469	3e-49
Q1ZXG8		166	Probable tyrosine-protein	no	no	0.685	0.879	0.445	1e-35
Q4P7L6		158	Putative tyrosine-protein	N/A	no	0.690	0.930	0.405	5e-29
Q6CTE4		210	Putative tyrosine-protein	no	no	0.708	0.719	0.392	2e-26
A5DE24		185	Putative tyrosine-protein	N/A	no	0.751	0.864	0.389	5e-26
Q6BLZ8		196	Putative tyrosine-protein	no	no	0.732	0.795	0.371	5e-26
Q9UUF3		287	Probable tyrosine-protein	yes	no	0.741	0.550	0.372	2e-25
Q75B37		225	Putative tyrosine-protein	no	no	0.718	0.68	0.386	7e-25
A3LW52		212	Putative tyrosine-protein	no	no	0.727	0.731	0.352	1e-23

>sp\|Q9ZVN4\|Y1500_ARATH Probable tyrosine-protein phosphatase At1g05000 OS=Arabidopsis thaliana GN=At1g05000 PE=1 SV=1	Back alignment and function desciption

 Score =  321 bits (823), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 155/205 (75%), Positives = 173/205 (84%), Gaps = 8/205 (3%)

Query: 17  EEEEAEQMCRTIEVASVVDLSPQPAP--------VVTGDEVTLIPPLNFSMVDNGIFRSG 68
           E++  E  CRTI   S V+ +   AP        VV+G+E+ LIPPLNFSMVDNGIFRSG
Sbjct: 11  EQDNGEDFCRTIIEVSEVNRNVFQAPGGEADPFRVVSGEELHLIPPLNFSMVDNGIFRSG 70

Query: 69  FPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDM 128
           FPDSANFSFLQTL LRSIIYLCPEPYPE+N +FLKSNGI+LFQF IEG+KEPFVNIP+  
Sbjct: 71  FPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNKEPFVNIPDHK 130

Query: 129 IREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVS 188
           IR ALKVLLD +NHPVLIHCKRGKHRTGCLVGCLRKLQKWCL+S+FDEYQRFAAAKARVS
Sbjct: 131 IRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQRFAAAKARVS 190

Query: 189 DQRFMELFDISSLKHLPMSFSCLKR 213
           DQRFME+FD+SS  H+PMSFSC  R
Sbjct: 191 DQRFMEIFDVSSFSHIPMSFSCSIR 215

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8

>sp\|P53965\|SIW14_YEAST Tyrosine-protein phosphatase SIW14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIW14 PE=1 SV=1	Back alignment and function description

>sp\|Q1ZXG8\|D1060_DICDI Probable tyrosine-protein phosphatase DG1060 OS=Dictyostelium discoideum GN=DG1060 PE=3 SV=1	Back alignment and function description

>sp\|Q4P7L6\|OCA1_USTMA Putative tyrosine-protein phosphatase OCA1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=OCA1 PE=3 SV=1	Back alignment and function description

>sp\|Q6CTE4\|OCA1_KLULA Putative tyrosine-protein phosphatase OCA1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=OCA1 PE=3 SV=1	Back alignment and function description

>sp\|A5DE24\|OCA1_PICGU Putative tyrosine-protein phosphatase OCA1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=OCA1 PE=3 SV=2	Back alignment and function description

>sp\|Q6BLZ8\|OCA1_DEBHA Putative tyrosine-protein phosphatase OCA1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=OCA1 PE=3 SV=1	Back alignment and function description

>sp\|Q9UUF3\|YNF3_SCHPO Probable tyrosine-protein phosphatase C17A3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi043 PE=1 SV=3	Back alignment and function description

>sp\|Q75B37\|OCA1_ASHGO Putative tyrosine-protein phosphatase OCA1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=OCA1 PE=3 SV=1	Back alignment and function description

>sp\|A3LW52\|OCA1_PICST Putative tyrosine-protein phosphatase OCA1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=OCA1 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		213
255587792		212	Tyrosine-protein phosphatase SIW14, puta	0.981	0.985	0.782	1e-91
225447153		210	PREDICTED: probable tyrosine-protein pho	0.929	0.942	0.787	3e-91
297843300		215	tyrosine specific protein phosphatase fa	0.929	0.920	0.765	3e-87
15220383		215	putative tyrosine-protein phosphatase [A	0.924	0.916	0.756	1e-85
356553721		216	PREDICTED: probable tyrosine-protein pho	0.887	0.875	0.810	1e-85
224131688		214	predicted protein [Populus trichocarpa]	0.788	0.785	0.869	5e-85
224064882		208	predicted protein [Populus trichocarpa]	0.901	0.923	0.760	2e-83
449517415		229	PREDICTED: probable tyrosine-protein pho	0.953	0.886	0.712	4e-83
357493185		220	Tyrosine specific protein phosphatase fa	0.934	0.904	0.732	5e-83
449450894		229	PREDICTED: probable tyrosine-protein pho	0.953	0.886	0.707	1e-82

>gi\|255587792\|ref\|XP_002534397.1\| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis] gi\|223525370\|gb\|EEF27985.1\| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 190/216 (87%), Gaps = 7/216 (3%)

Query: 1   MKVDNPS--KHKIQQQEEEEEEAEQMCRTIEVASVVDL-SPQPAPVVTGDEVTLIPPLNF 57
           MKV+  S   H     +++++E   MC+TIEVA VVDL  P P P+V GDE++ IPPLNF
Sbjct: 1   MKVNRHSVNSHATANSDDDDDE---MCKTIEVA-VVDLRDPPPPPLVVGDELSFIPPLNF 56

Query: 58  SMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGH 117
           SMVDNGIFRSGFPDSANFSFLQTL LRSII LCPEPYPE NTEFLK+NGI LFQF IEG+
Sbjct: 57  SMVDNGIFRSGFPDSANFSFLQTLELRSIICLCPEPYPELNTEFLKANGITLFQFGIEGY 116

Query: 118 KEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEY 177
           KEPFVNIPEDMIREALKV+LDVRNHPVL+HCKRGKHRTGC+VGCLRKLQ+WCL+S+FDEY
Sbjct: 117 KEPFVNIPEDMIREALKVVLDVRNHPVLVHCKRGKHRTGCVVGCLRKLQRWCLTSIFDEY 176

Query: 178 QRFAAAKARVSDQRFMELFDISSLKHLPMSFSCLKR 213
           QRFAAAKARVSDQRFMELFD+S+LKH+PMSFSC KR
Sbjct: 177 QRFAAAKARVSDQRFMELFDVSTLKHIPMSFSCSKR 212

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225447153\|ref\|XP_002275443.1\| PREDICTED: probable tyrosine-protein phosphatase At1g05000 isoform 1 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297843300\|ref\|XP_002889531.1\| tyrosine specific protein phosphatase family protein [Arabidopsis lyrata subsp. lyrata] gi\|297335373\|gb\|EFH65790.1\| tyrosine specific protein phosphatase family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi|15220383|ref|NP_171993.1| putative tyrosine-protein phosphatase [Arabidopsis thaliana] gi|73921030|sp|Q9ZVN4.1|Y1500_ARATH RecName: Full=Probable tyrosine-protein phosphatase At1g05000 gi|4056425|gb|AAC97999.1| ESTs gb|H36249, gb|AA59732 and gb|AA651219 come from this gene [Arabidopsis thaliana] gi|28950701|gb|AAO63274.1| At1g05000 [Arabidopsis thaliana] gi|110736114|dbj|BAF00029.1| hypothetical protein [Arabidopsis thaliana] gi|255957210|gb|ACU43461.1| PTP135 [Arabidopsis thaliana] gi|332189656|gb|AEE27777.1| putative tyrosine-protein phosphatase [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|356553721\|ref\|XP_003545201.1\| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Glycine max]	Back alignment and taxonomy information

>gi\|224131688\|ref\|XP_002321153.1\| predicted protein [Populus trichocarpa] gi\|222861926\|gb\|EEE99468.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224064882\|ref\|XP_002301598.1\| predicted protein [Populus trichocarpa] gi\|222843324\|gb\|EEE80871.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449517415\|ref\|XP_004165741.1\| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357493185\|ref\|XP_003616881.1\| Tyrosine specific protein phosphatase family protein [Medicago truncatula] gi\|355518216\|gb\|AES99839.1\| Tyrosine specific protein phosphatase family protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449450894\|ref\|XP_004143197.1\| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		213
TAIR\|locus:2205513		247	PFA-DSP1 "AT1G05000" [Arabidop	0.431	0.372	0.858	3.2e-77
TAIR\|locus:2059349		257	PFA-DSP2 "AT2G32960" [Arabidop	0.446	0.369	0.778	4.7e-72
TAIR\|locus:2136718		198	PFA-DSP4 "AT4G03960" [Arabidop	0.784	0.843	0.779	2.9e-71
TAIR\|locus:2075527		203	PFA-DSP3 "AT3G02800" [Arabidop	0.751	0.788	0.654	1.3e-54
TAIR\|locus:2171317		204	PFA-DSP5 "AT5G16480" [Arabidop	0.732	0.764	0.660	8e-53
DICTYBASE\|DDB_G0285909		181	DDB_G0285909 "putative protein	0.723	0.850	0.616	3.5e-52
SGD\|S000004977		281	SIW14 "Tyrosine phosphatase in	0.723	0.548	0.554	2.1e-45
CGD\|CAL0001689		281	SIW14 [Candida albicans (taxid	0.690	0.523	0.564	2.8e-43
UNIPROTKB\|Q59MU0		281	SIW14 "Putative uncharacterize	0.690	0.523	0.564	2.8e-43
DICTYBASE\|DDB_G0281953		166	DDB_G0281953 "putative tyrosin	0.685	0.879	0.445	1.2e-33

TAIR\|locus:2205513 PFA-DSP1 "AT1G05000" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 440 (159.9 bits), Expect = 3.2e-77, Sum P(2) = 3.2e-77
 Identities = 79/92 (85%), Positives = 86/92 (93%)

Query:   119 EPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQ 178
             EPFVNIP+  IR ALKVLLD +NHPVLIHCKRGKHRTGCLVGCLRKLQKWCL+S+FDEYQ
Sbjct:   153 EPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQ 212

Query:   179 RFAAAKARVSDQRFMELFDISSLKHLPMSFSC 210
             RFAAAKARVSDQRFME+FD+SS  H+PMSFSC
Sbjct:   213 RFAAAKARVSDQRFMEIFDVSSFSHIPMSFSC 244

GO:0004721 "phosphoprotein phosphatase activity" evidence=ISS

GO:0004725 "protein tyrosine phosphatase activity" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0016311 "dephosphorylation" evidence=IEA

GO:0016791 "phosphatase activity" evidence=IEA;IDA

GO:0007243 "intracellular protein kinase cascade" evidence=RCA

GO:0043407 "negative regulation of MAP kinase activity" evidence=RCA

TAIR\|locus:2059349 PFA-DSP2 "AT2G32960" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2136718 PFA-DSP4 "AT4G03960" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2075527 PFA-DSP3 "AT3G02800" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2171317 PFA-DSP5 "AT5G16480" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0285909 DDB_G0285909 "putative protein tyrosine phosphatase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

SGD\|S000004977 SIW14 "Tyrosine phosphatase involved in actin organization and endocytosis" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

CGD\|CAL0001689 SIW14 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

UNIPROTKB\|Q59MU0 SIW14 "Putative uncharacterized protein SIW14" [Candida albicans SC5314 (taxid:237561)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0281953 DDB_G0281953 "putative tyrosine phosphatase family protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9ZVN4	Y1500_ARATH	3, ., 1, ., 3, ., 4, 8	0.7560	0.9248	0.9162	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.1.3	0.766
3rd Layer	3.1.3.48	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00025953001	SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (210 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		213
pfam03162		150	pfam03162, Y_phosphatase2, Tyrosine phosphatase fa	3e-78
COG2365		249	COG2365, COG2365, Protein tyrosine/serine phosphat	2e-15
COG2453		180	COG2453, CDC14, Predicted protein-tyrosine phospha	9e-04
pfam13350		163	pfam13350, Y_phosphatase3, Tyrosine phosphatase fa	0.001
smart00195		138	smart00195, DSPc, Dual specificity phosphatase, ca	0.002
cd00127		139	cd00127, DSPc, Dual specificity phosphatases (DSP)	0.003
pfam00102		233	pfam00102, Y_phosphatase, Protein-tyrosine phospha	0.003

>gnl\|CDD\|111998 pfam03162, Y_phosphatase2, Tyrosine phosphatase family	Back alignment and domain information

 Score =  230 bits (589), Expect = 3e-78
 Identities = 87/150 (58%), Positives = 122/150 (81%)

Query: 51  LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLF 110
           L+PPLNFS V++G++RS +P + NFSFL++LRL++II L PEPYP+ N +FL+S  IKL+
Sbjct: 1   LVPPLNFSPVESGLYRSSYPRANNFSFLRSLRLKTIISLSPEPYPQDNLQFLESEHIKLY 60

Query: 111 QFAIEGHKEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 170
              +EG+K+PFVNIP  ++R ALK+LL+  N+PVLIHC RGKHRTG ++GCLRKLQKW L
Sbjct: 61  HIHMEGNKDPFVNIPSHLLRRALKLLLNKDNYPVLIHCNRGKHRTGLVIGCLRKLQKWSL 120

Query: 171 SSVFDEYQRFAAAKARVSDQRFMELFDISS 200
           +S+ +EY+RF+ +KAR+ D+ F+E+FD   
Sbjct: 121 ASILNEYRRFSGSKARIVDEEFIEIFDSEL 150

This family is closely related to the pfam00102 and pfam00782 families. Length = 150

>gnl\|CDD\|225240 COG2365, COG2365, Protein tyrosine/serine phosphatase [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|222063 pfam13350, Y_phosphatase3, Tyrosine phosphatase family	Back alignment and domain information

>gnl\|CDD\|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain	Back alignment and domain information

>gnl\|CDD\|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases	Back alignment and domain information

>gnl\|CDD\|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		213
PF03162		164	Y_phosphatase2: Tyrosine phosphatase family; Inter	100.0
KOG1572		249	consensus Predicted protein tyrosine phosphatase [	100.0
smart00195		138	DSPc Dual specificity phosphatase, catalytic domai	99.89
PF13350		164	Y_phosphatase3: Tyrosine phosphatase family; PDB:	99.88
TIGR01244		135	conserved hypothetical protein TIGR01244. No membe	99.88
cd00127		139	DSPc Dual specificity phosphatases (DSP); Ser/Thr	99.87
PTZ00242		166	protein tyrosine phosphatase; Provisional	99.82
PTZ00393		241	protein tyrosine phosphatase; Provisional	99.8
PF04273		110	DUF442: Putative phosphatase (DUF442); InterPro: I	99.79
PF00782		133	DSPc: Dual specificity phosphatase, catalytic doma	99.79
PRK12361		547	hypothetical protein; Provisional	99.75
PLN02727		986	NAD kinase	99.74
COG3453		130	Uncharacterized protein conserved in bacteria [Fun	99.68
COG2365		249	Protein tyrosine/serine phosphatase [Signal transd	99.66
KOG1720		225	consensus Protein tyrosine phosphatase CDC14 [Defe	99.63
PF05706		168	CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3)	99.61
KOG1719		183	consensus Dual specificity phosphatase [Defense me	99.56
KOG1718		198	consensus Dual specificity phosphatase [Defense me	99.56
KOG1716		285	consensus Dual specificity phosphatase [Defense me	99.52
KOG1717		343	consensus Dual specificity phosphatase [Defense me	99.45
COG2453		180	CDC14 Predicted protein-tyrosine phosphatase [Sign	99.34
KOG2836		173	consensus Protein tyrosine phosphatase IVA1 [Signa	99.2
smart00012		105	PTPc_DSPc Protein tyrosine phosphatase, catalytic	98.92
smart00404		105	PTPc_motif Protein tyrosine phosphatase, catalytic	98.92
PF14566		149	PTPlike_phytase: Inositol hexakisphosphate; PDB: 1	98.86
KOG2386		393	consensus mRNA capping enzyme, guanylyltransferase	98.57
cd00047		231	PTPc Protein tyrosine phosphatases (PTP) catalyze	98.56
KOG2283		434	consensus Clathrin coat dissociation kinase GAK/PT	98.53
smart00194		258	PTPc Protein tyrosine phosphatase, catalytic domai	98.5
PHA02742		303	protein tyrosine phosphatase; Provisional	98.37
PRK15375		535	pathogenicity island 1 effector protein StpP; Prov	98.31
PHA02740		298	protein tyrosine phosphatase; Provisional	98.3
PHA02746		323	protein tyrosine phosphatase; Provisional	98.22
PHA02747		312	protein tyrosine phosphatase; Provisional	98.21
PHA02738		320	hypothetical protein; Provisional	98.09
PF00102		235	Y_phosphatase: Protein-tyrosine phosphatase; Inter	97.96
COG5599		302	PTP2 Protein tyrosine phosphatase [Signal transduc	97.92
KOG0792		1144	consensus Protein tyrosine phosphatase PTPMEG, con	97.81
KOG0791		374	consensus Protein tyrosine phosphatase, contains f	97.7
COG5350		172	Predicted protein tyrosine phosphatase [General fu	97.64
KOG0790		600	consensus Protein tyrosine phosphatase Corkscrew a	97.23
KOG0789		415	consensus Protein tyrosine phosphatase [Signal tra	97.08
KOG4228		1087	consensus Protein tyrosine phosphatase [Signal tra	97.03
KOG0793		1004	consensus Protein tyrosine phosphatase [Signal tra	96.75
cd01448		122	TST_Repeat_1 Thiosulfate sulfurtransferase (TST),	94.7
cd01518		101	RHOD_YceA Member of the Rhodanese Homology Domain	94.21
PLN02160		136	thiosulfate sulfurtransferase	94.14
PF04343		122	DUF488: Protein of unknown function, DUF488; Inter	93.83
KOG4471		717	consensus Phosphatidylinositol 3-phosphate 3-phosp	93.74
KOG4228		1087	consensus Protein tyrosine phosphatase [Signal tra	93.72
PF06602		353	Myotub-related: Myotubularin-like phosphatase doma	93.56
COG0607		110	PspE Rhodanese-related sulfurtransferase [Inorgani	92.88
PF04179		451	Init_tRNA_PT: Initiator tRNA phosphoribosyl transf	92.87
cd01533		109	4RHOD_Repeat_2 Member of the Rhodanese Homology Do	92.33
cd01519		106	RHOD_HSP67B2 Member of the Rhodanese Homology Doma	91.95
cd01523		100	RHOD_Lact_B Member of the Rhodanese Homology Domai	91.9
KOG1089		573	consensus Myotubularin-related phosphatidylinosito	91.24
PRK01415		247	hypothetical protein; Validated	89.78
KOG1530		136	consensus Rhodanese-related sulfurtransferase [Ino	89.6
PRK00142		314	putative rhodanese-related sulfurtransferase; Prov	88.85
PF00581		113	Rhodanese: Rhodanese-like domain This Prosite entr	88.81
cd01528		101	RHOD_2 Member of the Rhodanese Homology Domain sup	88.26
TIGR02990		239	ectoine_eutA ectoine utilization protein EutA. Mem	88.1
smart00450		100	RHOD Rhodanese Homology Domain. An alpha beta fold	86.05
cd01527		99	RHOD_YgaP Member of the Rhodanese Homology Domain	83.6
PRK09875		292	putative hydrolase; Provisional	82.61
cd01522		117	RHOD_1 Member of the Rhodanese Homology Domain sup	82.53
PRK00162		108	glpE thiosulfate sulfurtransferase; Validated	82.47
cd01443		113	Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda	82.41
cd01526		122	RHOD_ThiF Member of the Rhodanese Homology Domain	81.12
PRK05600		370	thiamine biosynthesis protein ThiF; Validated	81.02
TIGR02981		101	phageshock_pspE phage shock operon rhodanese PspE.	80.99

>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity	Back alignment and domain information

Probab=100.00  E-value=1.6e-42  Score=282.63  Aligned_cols=153  Identities=54%  Similarity=0.961  Sum_probs=110.8

Q ss_pred             eeCCCCccccccceEEcCCCChhcHHHHHhcCCcEEEEcCCCCCCCchHhHhhhCCceEEEeeecCCCCCCCCCCHHHHH
Q 028110           51 LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDMIR  130 (213)
Q Consensus        51 l~p~~Nf~~V~~~Lyrs~~p~~~~~~~L~~lGIktVI~Lr~e~~~~~~~~~~~~~Gi~~~~ipi~d~~~p~~~i~~~~i~  130 (213)
                      |+||.||++|+++||||++|++.++++|+++|+||||+|++++++.....+++++||+++|+++.....+...++++.+.
T Consensus         1 lvpP~nF~~V~~~vYRS~~P~~~n~~fL~~L~LKTII~L~~e~~~~~~~~f~~~~~I~l~~~~~~~~~~~~~~~~~~~v~   80 (164)
T PF03162_consen    1 LVPPLNFGMVEPGVYRSAQPTPANFPFLERLGLKTIINLRPEPPSQDFLEFAEENGIKLIHIPMSSSKDPWVPISEEQVA   80 (164)
T ss_dssp             B---TT-EEEETTEEEESS--HHHHHHHHHHT-SEEEE--SS---HHHHHHHHHTT-EEEE-------GGG----HHHHH
T ss_pred             CcCCccccCCCCCccCCCCCChhhHHHHHHCCCceEEEecCCCCCHHHHHHHhhcCceEEEeccccccCccccCCHHHHH
Confidence            58999999999999999999999999999999999999999987777788999999999999999877766677889999


Q ss_pred             HHHHHHHhcCCCcEEEEcCCCCChHHHHHHHHHHHCCCCHHHHHHHHHhHhcccCCchHHHHHHHhccccccc
Q 028110          131 EALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFDISSLKH  203 (213)
Q Consensus       131 ~al~~i~d~~~~PVLVHC~~Gk~RTG~vva~yl~~~gws~e~al~ey~~~~~~~~~~~~~~fie~f~~~~~~~  203 (213)
                      ++++.|++..++||||||.+|++|||+|+||||++|||++++|++||++|+.++.+..+++|||.|+.+++..
T Consensus        81 ~aL~~ild~~n~PvLiHC~~G~~rTG~vvg~lRk~Q~W~~~~i~~Ey~~f~~~~~~~~~~~fIe~f~~~~~~~  153 (164)
T PF03162_consen   81 EALEIILDPRNYPVLIHCNHGKDRTGLVVGCLRKLQGWSLSSIFDEYRRFAGPKIRYLDEQFIELFDVELVVP  153 (164)
T ss_dssp             HHHHHHH-GGG-SEEEE-SSSSSHHHHHHHHHHHHTTB-HHHHHHHHHHHHGGG--HHHHHHHHT--------
T ss_pred             HHHHHHhCCCCCCEEEEeCCCCcchhhHHHHHHHHcCCCHHHHHHHHHHhcCCCCcHHHHHHHHhcCcceecc
Confidence            9999999989999999999999999999999999999999999999999999988999999999999988754

Consequently, maintaining an appropriate level of protein tyrosine phosphorylation is essential for many cellular functions. Tyrosine-specific protein phosphatases (PTPase; 3.1.3.48 from EC) catalyse the removal of a phosphate group attached to a tyrosine residue, using a cysteinyl-phosphate enzyme intermediate. These enzymes are key regulatory components in signal transduction pathways (such as the MAP kinase pathway) and cell cycle control, and are important in the control of cell growth, proliferation, differentiation and transformation [, ]. The PTP superfamily can be divided into four subfamilies []: (1) pTyr-specific phosphatases (2) dual specificity phosphatases (dTyr and dSer/dThr) (3) Cdc25 phosphatases (dTyr and/or dThr) (4) LMW (low molecular weight) phosphatases Based on their cellular localisation, PTPases are also classified as: Receptor-like, which are transmembrane receptors that contain PTPase domains [] Non-receptor (intracellular) PTPases [] All PTPases carry the highly conserved active site motif C(X)5R (PTP signature motif), employ a common catalytic mechanism, and share a similar core structure made of a central parallel beta-sheet with flanking alpha-helices containing a beta-loop-alpha-loop that encompasses the PTP signature motif []. Functional diversity between PTPases is endowed by regulatory domains and subunits. This entry represents protein-tyrosine phosphatases predominantly from fungi, plants and bacteria, several of which are putative enzymes. These proteins are closely related to the Y-phosphatase and DSPc families. This entry includes the PTPase SIW14 from Saccharomyces cerevisiae (Baker's yeast), which plays a role in actin filament organisation and endocytosis.; PDB: 2Q47_A 1XRI_A.

>KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms]	Back alignment and domain information

>smart00195 DSPc Dual specificity phosphatase, catalytic domain	Back alignment and domain information

>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B	Back alignment and domain information

>TIGR01244 conserved hypothetical protein TIGR01244	Back alignment and domain information

>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases	Back alignment and domain information

>PTZ00242 protein tyrosine phosphatase; Provisional	Back alignment and domain information

>PTZ00393 protein tyrosine phosphatase; Provisional	Back alignment and domain information

>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function	Back alignment and domain information

>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity	Back alignment and domain information

>PRK12361 hypothetical protein; Provisional	Back alignment and domain information

>PLN02727 NAD kinase	Back alignment and domain information

>COG3453 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms]	Back alignment and domain information

>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species	Back alignment and domain information

>KOG1719 consensus Dual specificity phosphatase [Defense mechanisms]	Back alignment and domain information

>KOG1718 consensus Dual specificity phosphatase [Defense mechanisms]	Back alignment and domain information

>KOG1716 consensus Dual specificity phosphatase [Defense mechanisms]	Back alignment and domain information

>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms]	Back alignment and domain information

>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms]	Back alignment and domain information

>KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms]	Back alignment and domain information

>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity	Back alignment and domain information

>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif	Back alignment and domain information

>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B	Back alignment and domain information

>KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification]	Back alignment and domain information

>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways	Back alignment and domain information

>KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain	Back alignment and domain information

>PHA02742 protein tyrosine phosphatase; Provisional	Back alignment and domain information

>PRK15375 pathogenicity island 1 effector protein StpP; Provisional	Back alignment and domain information

>PHA02740 protein tyrosine phosphatase; Provisional	Back alignment and domain information

>PHA02746 protein tyrosine phosphatase; Provisional	Back alignment and domain information

>PHA02747 protein tyrosine phosphatase; Provisional	Back alignment and domain information

>PHA02738 hypothetical protein; Provisional	Back alignment and domain information

>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity	Back alignment and domain information

>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms]	Back alignment and domain information

>COG5350 Predicted protein tyrosine phosphatase [General function prediction only]	Back alignment and domain information

>KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms]	Back alignment and domain information

>KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms]	Back alignment and domain information

>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain	Back alignment and domain information

>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>PLN02160 thiosulfate sulfurtransferase	Back alignment and domain information

>PF04343 DUF488: Protein of unknown function, DUF488; InterPro: IPR007438 This family includes several proteins of uncharacterised function	Back alignment and domain information

>KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms]	Back alignment and domain information

>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO	Back alignment and domain information

>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2	Back alignment and domain information

>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2	Back alignment and domain information

>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>KOG1089 consensus Myotubularin-related phosphatidylinositol 3-phosphate 3-phosphatase MTM6 [General function prediction only]	Back alignment and domain information

>PRK01415 hypothetical protein; Validated	Back alignment and domain information

>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK00142 putative rhodanese-related sulfurtransferase; Provisional	Back alignment and domain information

>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family	Back alignment and domain information

>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2	Back alignment and domain information

>TIGR02990 ectoine_eutA ectoine utilization protein EutA	Back alignment and domain information

>smart00450 RHOD Rhodanese Homology Domain	Back alignment and domain information

>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>PRK09875 putative hydrolase; Provisional	Back alignment and domain information

>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1	Back alignment and domain information

>PRK00162 glpE thiosulfate sulfurtransferase; Validated	Back alignment and domain information

>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily	Back alignment and domain information

>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>PRK05600 thiamine biosynthesis protein ThiF; Validated	Back alignment and domain information

>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		213
1xri_A		151	X-ray Structure Of A Putative Phosphoprotein Phosph		7e-76

>pdb|1XRI|A Chain A, X-ray Structure Of A Putative Phosphoprotein Phosphatase From Arabidopsis Thaliana Gene At1g05000 Length = 151

Back alignment and structure

Iteration: 1

Score = 279 bits (714), Expect = 7e-76, Method: Compositional matrix adjust. Identities = 131/150 (87%), Positives = 141/150 (94%) Query: 51 LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLF 110 LIPPLNFS VDNGIFRSGFPDSANFSFLQTL LRSIIYLCPEPYPE+N +FLKSNGI+LF Sbjct: 2 LIPPLNFSXVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLF 61 Query: 111 QFAIEGHKEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 170 QF IEG+KEPFVNIP+ IR ALKVLLD +NHPVLIHCKRGKHRTGCLVGCLRKLQKWCL Sbjct: 62 QFGIEGNKEPFVNIPDHKIRXALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 121 Query: 171 SSVFDEYQRFAAAKARVSDQRFMELFDISS 200 +S+FDEYQRFAAAKARVSDQRF E+FD+SS Sbjct: 122 TSIFDEYQRFAAAKARVSDQRFXEIFDVSS 151

PyMOL of 1xri

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		213
1xri_A		151	AT1G05000; structural genomics, protein structure	2e-65
3gxh_A		157	Putative phosphatase (DUF442); YP_001181608.1, str	6e-19
2img_A		151	Dual specificity protein phosphatase 23; DUSP23, V	3e-12
2f46_A		156	Hypothetical protein; structural genomics, joint c	4e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-09
3rgo_A		157	Protein-tyrosine phosphatase mitochondrial 1; phos	1e-07
3s4o_A		167	Protein tyrosine phosphatase-like protein; structu	1e-07
2i6j_A		161	Ssoptp, sulfolobus solfataricus protein tyrosine p	2e-07
1ohe_A		348	CDC14B, CDC14B2 phosphatase; protein phosphatase,	8e-07
3rz2_A		189	Protein tyrosine phosphatase type IVA 1; tyrosine	1e-06
2c46_A		241	MRNA capping enzyme; phosphatase, transferase, hyd	3e-06
1rxd_A		159	Protein tyrosine phosphatase type IVA, member 1; p	3e-06
1yn9_A		169	BVP, polynucleotide 5'-phosphatase; RNA triphospha	3e-06
1fpz_A		212	Cyclin-dependent kinase inhibitor 3; alpha-beta sa	2e-04
2pq5_A		205	Dual specificity protein phosphatase 13; hydrolase	6e-04

>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151	Back alignment and structure

 Score =  198 bits (504), Expect = 2e-65
 Identities = 133/150 (88%), Positives = 143/150 (95%)

Query: 51  LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLF 110
           LIPPLNFSMVDNGIFRSGFPDSANFSFLQTL LRSIIYLCPEPYPE+N +FLKSNGI+LF
Sbjct: 2   LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLF 61

Query: 111 QFAIEGHKEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 170
           QF IEG+KEPFVNIP+  IR ALKVLLD +NHPVLIHCKRGKHRTGCLVGCLRKLQKWCL
Sbjct: 62  QFGIEGNKEPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 121

Query: 171 SSVFDEYQRFAAAKARVSDQRFMELFDISS 200
           +S+FDEYQRFAAAKARVSDQRFME+FD+SS
Sbjct: 122 TSIFDEYQRFAAAKARVSDQRFMEIFDVSS 151

PyMOL of 1xri

>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157	Back alignment and structure

>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151	Back alignment and structure

>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Length = 156	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157	Back alignment and structure

>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167	Back alignment and structure

>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161	Back alignment and structure

>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348	Back alignment and structure

>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189	Back alignment and structure

>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241	Back alignment and structure

>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159	Back alignment and structure

>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169	Back alignment and structure

>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212	Back alignment and structure

>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		213
1xri_A		151	AT1G05000; structural genomics, protein structure	100.0
4erc_A		150	Dual specificity protein phosphatase 23; alpha bet	99.94
3f81_A		183	Dual specificity protein phosphatase 3; hydrolase,	99.93
2img_A		151	Dual specificity protein phosphatase 23; DUSP23, V	99.93
3rgo_A		157	Protein-tyrosine phosphatase mitochondrial 1; phos	99.92
2f46_A		156	Hypothetical protein; structural genomics, joint c	99.91
2e0t_A		151	Dual specificity phosphatase 26; conserved hypothe	99.91
1zzw_A		149	Dual specificity protein phosphatase 10; MKP, PTP,	99.91
2i6j_A		161	Ssoptp, sulfolobus solfataricus protein tyrosine p	99.9
1yz4_A		160	DUSP15, dual specificity phosphatase-like 15 isofo	99.9
2oud_A		177	Dual specificity protein phosphatase 10; A central	99.89
3ezz_A		144	Dual specificity protein phosphatase 4; alpha/beta	99.89
2hcm_A		164	Dual specificity protein phosphatase; structural g	99.89
3s4e_A		144	Dual specificity protein phosphatase 19; PTP, prot	99.89
1fpz_A		212	Cyclin-dependent kinase inhibitor 3; alpha-beta sa	99.89
1wrm_A		165	Dual specificity phosphatase 22; DSP, JNK, hydrola	99.88
3emu_A		161	Leucine rich repeat and phosphatase domain contain	99.88
2hxp_A		155	Dual specificity protein phosphatase 9; human phos	99.88
2pq5_A		205	Dual specificity protein phosphatase 13; hydrolase	99.88
1ywf_A		296	Phosphotyrosine protein phosphatase PTPB; four str	99.88
2y96_A		219	Dual specificity phosphatase DUPD1; hydrolase; 2.3	99.87
2esb_A		188	Dual specificity protein phosphatase 18; alpha/bet	99.87
2nt2_A		145	Protein phosphatase slingshot homolog 2; alpha/bet	99.87
2r0b_A		154	Serine/threonine/tyrosine-interacting protein; str	99.87
3s4o_A		167	Protein tyrosine phosphatase-like protein; structu	99.87
2wgp_A		190	Dual specificity protein phosphatase 14; MKP6, DUS	99.87
1rxd_A		159	Protein tyrosine phosphatase type IVA, member 1; p	99.86
1ohe_A		348	CDC14B, CDC14B2 phosphatase; protein phosphatase,	99.86
2g6z_A		211	Dual specificity protein phosphatase 5; alpha/beta	99.85
2q05_A		195	Late protein H1, dual specificity protein phosphat	99.84
3rz2_A		189	Protein tyrosine phosphatase type IVA 1; tyrosine	99.84
3cm3_A		176	Late protein H1, dual specificity protein phosphat	99.84
3nme_A		294	Ptpkis1 protein, SEX4 glucan phosphatase; dual spe	99.83
1yn9_A		169	BVP, polynucleotide 5'-phosphatase; RNA triphospha	99.8
3gxh_A		157	Putative phosphatase (DUF442); YP_001181608.1, str	99.79
2j16_A		182	SDP-1, tyrosine-protein phosphatase YIL113W; hydro	99.74
2c46_A		241	MRNA capping enzyme; phosphatase, transferase, hyd	99.74
1d5r_A		324	Phosphoinositide phosphotase PTEN; C2 domain, phos	99.65
3v0d_A		339	Voltage-sensor containing phosphatase; PTP, hydrol	99.43
3n0a_A		361	Tyrosine-protein phosphatase auxilin; phosphatase-	99.41
3mmj_A		314	MYO-inositol hexaphosphate phosphohydrolase; phyta	99.39
3f41_A		629	Phytase; tandem repeat, protein tyrosine phosphata	99.16
3f41_A		629	Phytase; tandem repeat, protein tyrosine phosphata	99.15
1g4w_R		383	Protein tyrosine phosphatase SPTP; virulence facto	98.8
1jln_A		297	STEP-like ptpase, protein tyrosine phosphatase, re	98.75
1zc0_A		309	Tyrosine-protein phosphatase, non-receptor type 7;	98.75
1fpr_A		284	Protein-tyrosine phosphatase 1C; protein tyrosine	98.71
2cjz_A		305	Human protein tyrosine phosphatase PTPN5; protein	98.68
1wch_A		315	Protein tyrosine phosphatase, non-receptor type 13	98.67
4az1_A		302	Tyrosine specific protein phosphatase; hydrolase,	98.65
3b7o_A		316	Tyrosine-protein phosphatase non-receptor type 11;	98.63
1l8k_A		314	T-cell protein-tyrosine phosphatase; hydrolase; 2.	98.62
1p15_A		253	Protein-tyrosine phosphatase alpha; transmembrane,	98.61
3m4u_A		306	Tyrosine specific protein phosphatase, putative; p	98.6
2hc1_A		291	Receptor-type tyrosine-protein phosphatase beta; p	98.6
2oc3_A		303	Tyrosine-protein phosphatase non-receptor type 18;	98.59
4grz_A		288	Tyrosine-protein phosphatase non-receptor type 6;	98.56
2ooq_A		286	Receptor-type tyrosine-protein phosphatase T; prot	98.56
2b49_A		287	Protein tyrosine phosphatase, non-receptor type 3;	98.55
2cm2_A		304	Tyrosine-protein phosphatase non-receptor type 1;	98.55
2bzl_A		325	Tyrosine-protein phosphatase, non-receptor type 14	98.54
2i75_A		320	Tyrosine-protein phosphatase non-receptor type 4;	98.54
2i1y_A		301	Receptor-type tyrosine-protein phosphatase; recept	98.53
2p6x_A		309	Tyrosine-protein phosphatase non-receptor type 22;	98.53
1yfo_A		302	D1, receptor protein tyrosine phosphatase alpha; h	98.49
1lyv_A		306	Protein-tyrosine phosphatase YOPH; toxin, hydrolas	98.49
4i8n_A		354	Tyrosine-protein phosphatase non-receptor type 1;	98.44
3s3e_A		307	Tyrosine-protein phosphatase 10D; differentiation,	98.44
2gjt_A		295	Receptor-type tyrosine-protein phosphatase PTPro;	98.4
2h4v_A		320	Receptor-type tyrosine-protein phosphatase gamma;	98.4
3i36_A		342	Vascular protein tyrosine phosphatase 1; PTP, hydr	98.39
4ge6_A		314	Tyrosine-protein phosphatase non-receptor type 9;	98.38
2b3o_A		532	Tyrosine-protein phosphatase, non-receptor type 6;	98.37
1ygr_A		610	CD45 protein tyrosine phosphatase; protein tyrosin	98.36
2shp_A		525	SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin	98.29
3ps5_A		595	Tyrosine-protein phosphatase non-receptor type 6;	98.27
1lar_A		575	Protein (LAR); tyrosine phosphatease, LAR protein,	98.25
2jjd_A		599	Receptor-type tyrosine-protein phosphatase epsilo;	98.23
2jjd_A		599	Receptor-type tyrosine-protein phosphatase epsilo;	98.19
1lar_A		575	Protein (LAR); tyrosine phosphatease, LAR protein,	98.19
1ygr_A		610	CD45 protein tyrosine phosphatase; protein tyrosin	98.18
2nlk_A		627	Protein tyrosine phosphatase, receptor type, G VA	98.1
2nlk_A		627	Protein tyrosine phosphatase, receptor type, G VA	97.95
1ohe_A		348	CDC14B, CDC14B2 phosphatase; protein phosphatase,	93.52
1vee_A		134	Proline-rich protein family; hypothetical protein,	92.92
2yf0_A		512	Myotubularin-related protein 6; hydrolase; 2.65A {	92.28
1zsq_A		528	Myotubularin-related protein 2; protein-phospholip	91.85
1lw3_A		657	Myotubularin-related protein 2; protein-phosphate	90.94
3d1p_A		139	Putative thiosulfate sulfurtransferase YOR285W; at	89.79
3i2v_A		127	Adenylyltransferase and sulfurtransferase MOCS3; r	87.56
1wv9_A		94	Rhodanese homolog TT1651; CDC25, phosphatase, sulf	87.35
2jtq_A		85	Phage shock protein E; solution structure rhodanes	87.19
1urh_A		280	3-mercaptopyruvate sulfurtransferase; rhodanese; 2	82.15
1gmx_A		108	GLPE protein; transferase, rhodanese, sulfurtransf	80.65
1tq1_A		129	AT5G66040, senescence-associated family protein; C	80.48

>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A	Back alignment and structure

Probab=100.00  E-value=3.7e-36  Score=237.30  Aligned_cols=151  Identities=88%  Similarity=1.460  Sum_probs=135.0

Q ss_pred             eeeCCCCccccccceEEcCCCChhcHHHHHhcCCcEEEEcCCCCCCCchHhHhhhCCceEEEeeecCCCCCCCCCCHHHH
Q 028110           50 TLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDMI  129 (213)
Q Consensus        50 ~l~p~~Nf~~V~~~Lyrs~~p~~~~~~~L~~lGIktVI~Lr~e~~~~~~~~~~~~~Gi~~~~ipi~d~~~p~~~i~~~~i  129 (213)
                      .|+||.||.+|.++||||++|.+.++++|+++||++|||||++.+.....++++..|++|+++|+.+...|+..++.+.+
T Consensus         1 ~~~pp~n~~~v~~~l~~s~~~~~~d~~~L~~~gi~~Vi~l~~~~e~~~~~~~~~~~gi~~~~ipi~d~~~~~~~~~~~~~   80 (151)
T 1xri_A            1 HLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNKEPFVNIPDHKI   80 (151)
T ss_dssp             CBCCCTTCEEEETTEEEESCCCHHHHHHHHHHTCSEEEECCSSCCCHHHHHHHHHHTCEEEECCCCCCCGGGCCCCHHHH
T ss_pred             CccCCcCcCeeCCCeEECCCcCccCHHHHHHCCCCEEEECCCCCcChhHHHHHHhcCCeEEecccccccCccccCCHHHH
Confidence            37899999999999999999999999999999999999999986554556677778999999999997666656677789


Q ss_pred             HHHHHHHHhcCCCcEEEEcCCCCChHHHHHHHHHHHCCCCHHHHHHHHHhHhcccCCchHHHHHHHhcccc
Q 028110          130 REALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFDISS  200 (213)
Q Consensus       130 ~~al~~i~d~~~~PVLVHC~~Gk~RTG~vva~yl~~~gws~e~al~ey~~~~~~~~~~~~~~fie~f~~~~  200 (213)
                      .++++++.+..++||||||++|+||||+++|+|++.+||+.++|+++|++++..+.+..+++|++.|++++
T Consensus        81 ~~~~~~i~~~~~~~vlvHC~aG~~RTg~~~a~~l~~~g~~~~~a~~~~~~~~~~~~~~~~~qfi~~~~~~~  151 (151)
T 1xri_A           81 RMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQRFAAAKARVSDQRFMEIFDVSS  151 (151)
T ss_dssp             HHHHHHHHCGGGCSEEEECSSSSSHHHHHHHHHHHHTTBCHHHHHHHHHHHHGGGCCHHHHHHHHTCCCCC
T ss_pred             HHHHHHHHcCCCCCEEEECCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHhcCCCccchHHHHHHHhcCCC
Confidence            88999988767899999999999999999999999999999999999999987767778999999999863

PyMOL of 1xri

>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A	Back alignment and structure

>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A*	Back alignment and structure

>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens}	Back alignment and structure

>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A*	Back alignment and structure

>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491}	Back alignment and structure

>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens}	Back alignment and structure

>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens}	Back alignment and structure

>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A*	Back alignment and structure

>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens}	Back alignment and structure

>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens}	Back alignment and structure

>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A	Back alignment and structure

>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus}	Back alignment and structure

>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens}	Back alignment and structure

>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A*	Back alignment and structure

>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens}	Back alignment and structure

>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica}	Back alignment and structure

>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A	Back alignment and structure

>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A	Back alignment and structure

>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A*	Back alignment and structure

>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens}	Back alignment and structure

>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens}	Back alignment and structure

>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens}	Back alignment and structure

>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens}	Back alignment and structure

>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major}	Back alignment and structure

>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens}	Back alignment and structure

>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A	Back alignment and structure

>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A	Back alignment and structure

>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens}	Back alignment and structure

>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR}	Back alignment and structure

>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A	Back alignment and structure

>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A	Back alignment and structure

>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus}	Back alignment and structure

>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A*	Back alignment and structure

>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A	Back alignment and structure

>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1	Back alignment and structure

>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A	Back alignment and structure

>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus}	Back alignment and structure

>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A	Back alignment and structure

>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida}	Back alignment and structure

>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida}	Back alignment and structure

>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S	Back alignment and structure

>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A	Back alignment and structure

>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A	Back alignment and structure

>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A	Back alignment and structure

>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A*	Back alignment and structure

>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2	Back alignment and structure

>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi}	Back alignment and structure

>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A*	Back alignment and structure

>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2	Back alignment and structure

>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2	Back alignment and structure

>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei}	Back alignment and structure

>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A	Back alignment and structure

>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens}	Back alignment and structure

>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A*	Back alignment and structure

>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A	Back alignment and structure

>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens}	Back alignment and structure

>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ...	Back alignment and structure

>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens}	Back alignment and structure

>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens}	Back alignment and structure

>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A	Back alignment and structure

>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A*	Back alignment and structure

>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2	Back alignment and structure

>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A	Back alignment and structure

>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens}	Back alignment and structure

>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A*	Back alignment and structure

>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A	Back alignment and structure

>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A	Back alignment and structure

>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A	Back alignment and structure

>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A*	Back alignment and structure

>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A*	Back alignment and structure

>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A*	Back alignment and structure

>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1	Back alignment and structure

>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens}	Back alignment and structure

>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A	Back alignment and structure

>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens}	Back alignment and structure

>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens}	Back alignment and structure

>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A	Back alignment and structure

>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A*	Back alignment and structure

>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens}	Back alignment and structure

>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens}	Back alignment and structure

>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A	Back alignment and structure

>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A	Back alignment and structure

>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens}	Back alignment and structure

>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A*	Back alignment and structure

>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A	Back alignment and structure

>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae}	Back alignment and structure

>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens}	Back alignment and structure

>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus}	Back alignment and structure

>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A	Back alignment and structure

>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2	Back alignment and structure

>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A	Back alignment and structure

>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		213
d1xria_		151	c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal	1e-55
d1vhra_		178	c.45.1.1 (A:) VH1-related dual-specificity phospha	1e-09
d1rxda_		152	c.45.1.1 (A:) Protein tyrosine phosphatase type IV	2e-08
d1ohea2		182	c.45.1.1 (A:199-380) Proline directed phosphatase	3e-08
d1i9sa_		194	c.45.1.1 (A:) mRNA capping enzyme, triphosphatase	2e-06
d1fpza_		176	c.45.1.1 (A:) Kinase associated phosphatase (kap)	4e-06
d1d5ra2		174	c.45.1.1 (A:14-187) Phoshphoinositide phosphatase	5e-05
d1ywfa1		272	c.45.1.5 (A:4-275) Phosphotyrosine protein phospha	2e-04
d1m3ga_		145	c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien	0.001
d2pt0a1		313	c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho	0.002

>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Putative phosphatase At1g05000
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  172 bits (436), Expect = 1e-55
 Identities = 133/150 (88%), Positives = 143/150 (95%)

Query: 51  LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLF 110
           LIPPLNFSMVDNGIFRSGFPDSANFSFLQTL LRSIIYLCPEPYPE+N +FLKSNGI+LF
Sbjct: 2   LIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLF 61

Query: 111 QFAIEGHKEPFVNIPEDMIREALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 170
           QF IEG+KEPFVNIP+  IR ALKVLLD +NHPVLIHCKRGKHRTGCLVGCLRKLQKWCL
Sbjct: 62  QFGIEGNKEPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCL 121

Query: 171 SSVFDEYQRFAAAKARVSDQRFMELFDISS 200
           +S+FDEYQRFAAAKARVSDQRFME+FD+SS
Sbjct: 122 TSIFDEYQRFAAAKARVSDQRFMEIFDVSS 151

PyMOL of d1xria_

>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178	Back information, alignment and structure

>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152	Back information, alignment and structure

>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182	Back information, alignment and structure

>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194	Back information, alignment and structure

>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176	Back information, alignment and structure

>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174	Back information, alignment and structure

>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 272	Back information, alignment and structure

>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145	Back information, alignment and structure

>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		213
d1xria_		151	Putative phosphatase At1g05000 {Thale cress (Arabi	100.0
d1ohea2		182	Proline directed phosphatase CDC14b2 {Human (Homo	99.89
d1vhra_		178	VH1-related dual-specificity phosphatase, VHR {Hum	99.88
d1fpza_		176	Kinase associated phosphatase (kap) {Human (Homo s	99.84
d1rxda_		152	Protein tyrosine phosphatase type IVa {Human (Homo	99.84
d1mkpa_		144	Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp	99.82
d1ywfa1		272	Phosphotyrosine protein phosphatase PtpB {Mycobact	99.81
d1m3ga_		145	Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax	99.8
d1i9sa_		194	mRNA capping enzyme, triphosphatase domain {Mouse	99.66
d1d5ra2		174	Phoshphoinositide phosphatase Pten (Pten tumor sup	99.54
d2pt0a1		313	Myo-inositol hexaphosphate phosphohydrolase (phyta	99.27
d1g4us2		243	SptP tyrosine phosphatase, catalytic domain {Salmo	98.64
d1wcha_		308	Tyrosine-protein phosphatase, non-receptor type 13	98.4
d1lyva_		283	Protein-tyrosine phosphatase YopH, catalytic domai	98.26
d1jlna_		297	Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl	98.23
d1lara1		317	RPTP Lar {Human (Homo sapiens) [TaxId: 9606]}	98.21
d2shpa1		307	Tyrosine phosphatase {Human (Homo sapiens), shp-2	98.17
d1l8ka_		273	Tyrosine phosphatase {Human (Homo sapiens), T-cell	98.16
d1yfoa_		288	Tyrosine phosphatase {Mouse (Mus musculus) [TaxId:	98.14
d1fpra_		284	Tyrosine phosphatase {Human (Homo sapiens), shp-1	98.11
d1rpma_		278	Tyrosine phosphatase {Human (Homo sapiens), mu [Ta	98.11
d1p15a_		245	Protein-tyrosine phosphatase alpha {Mouse (Mus mus	98.08
d2f71a1		297	Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta	98.05
d1lara2		249	RPTP Lar {Human (Homo sapiens) [TaxId: 9606]}	97.91
d1tq1a_		119	Thiosulfate sulfurtransferase/Senescence-associate	93.91
d1zsqa2		387	Myotubularin-related protein 2, C-terminal domain	92.77
d1urha2		120	3-mercaptopyruvate sulfurtransferase {Escherichia	92.42
d1yt8a4		130	Thiosulfate sulfurtransferase PA2603 {Pseudomonas	86.34
d1ohea1		157	Proline directed phosphatase CDC14b2 {Human (Homo	84.95
d1gmxa_		108	Sulfurtransferase GlpE {Escherichia coli [TaxId: 5	84.13
d1uara2		141	Sulfurtransferase {Thermus thermophilus [TaxId: 27	82.31
d1rhsa2		144	Rhodanese {Cow (Bos taurus) [TaxId: 9913]}	81.35

>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Putative phosphatase At1g05000
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=1.1e-40  Score=263.35  Aligned_cols=150  Identities=88%  Similarity=1.465  Sum_probs=138.9

Q ss_pred             eeeCCCCccccccceEEcCCCChhcHHHHHhcCCcEEEEcCCCCCCCchHhHhhhCCceEEEeeecCCCCCCCCCCHHHH
Q 028110           50 TLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLRLRSIIYLCPEPYPEANTEFLKSNGIKLFQFAIEGHKEPFVNIPEDMI  129 (213)
Q Consensus        50 ~l~p~~Nf~~V~~~Lyrs~~p~~~~~~~L~~lGIktVI~Lr~e~~~~~~~~~~~~~Gi~~~~ipi~d~~~p~~~i~~~~i  129 (213)
                      +++||.||++|+++||||++|++.++++|+++|||+|||||++++.....+++...||+++++|+.+...+......+.+
T Consensus         1 ~~~pp~nF~~V~~~lyRs~~~t~~~~~~L~~lgIktIidLr~~~e~~~~~~~~~~~gi~~~~ip~~~~~~~~~~~~~~~~   80 (151)
T d1xria_           1 HLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNKEPFVNIPDHKI   80 (151)
T ss_dssp             CBCCCTTCEEEETTEEEESCCCHHHHHHHHHHTCSEEEECCSSCCCHHHHHHHHHHTCEEEECCCCCCCGGGCCCCHHHH
T ss_pred             CCCCCcccceecCCceecCCCCHHHHHHHHHCCCCEEEECCCcchhhcccchhhhcCceEeecCccccccccccccHHHH
Confidence            58999999999999999999999999999999999999999987766778888999999999999988766556667889


Q ss_pred             HHHHHHHHhcCCCcEEEEcCCCCChHHHHHHHHHHHCCCCHHHHHHHHHhHhcccCCchHHHHHHHhccc
Q 028110          130 REALKVLLDVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFDIS  199 (213)
Q Consensus       130 ~~al~~i~d~~~~PVLVHC~~Gk~RTG~vva~yl~~~gws~e~al~ey~~~~~~~~~~~~~~fie~f~~~  199 (213)
                      ..+++.+.+..++||||||++||||||+++|+||+++||+.++|++||++++....+..+++|||.|+.+
T Consensus        81 ~~~~~~~~~~~~~pvlvHC~~GkdRTG~v~a~~l~~~g~~~~~i~~dy~~~~~~~~~~~~~~fiE~f~~~  150 (151)
T d1xria_          81 RMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQRFAAAKARVSDQRFMEIFDVS  150 (151)
T ss_dssp             HHHHHHHHCGGGCSEEEECSSSSSHHHHHHHHHHHHTTBCHHHHHHHHHHHHGGGCCHHHHHHHHTCCCC
T ss_pred             HHHHHHHhcCCCCCEEEEcCCCchHHHHHHHHHHHHcCCCHHHHHHHHHHhccCcccHHHHHHHHHhCCC
Confidence            9999999888899999999999999999999999999999999999999999887788899999999975

PyMOL of d1xria_

>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]}	Back information, alignment and structure

>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]}	Back information, alignment and structure

>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]}	Back information, alignment and structure

>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]}	Back information, alignment and structure

>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}	Back information, alignment and structure

>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]}	Back information, alignment and structure

>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]}	Back information, alignment and structure

>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]}	Back information, alignment and structure

>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]}	Back information, alignment and structure

>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]}	Back information, alignment and structure

>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}	Back information, alignment and structure

>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure