Citrus Sinensis ID: 028112

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---

MAAIAWPYKLSPKVDCSHEYSKSVKKLTITPHYLSFSSSSTEQNIKFPVSKTNHLSNTTANSPLYATLNGPRGFGPPPKKTKKAKKPKTGNDSDDDEDEEGDEAEAGVIPEIVTNRMISRIGFTVGIPLLVGLLFFPFFYYLKVVLKIDVPSWLPVIVSFIFFGAALLGVNYGIVSSSWDPLREGSLLGWNEAQRNWPVFWQSLWSGGGSRKK

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEccCCcccHHHHHHHHHHHHHHHHHHHHEEEccccccccccccccHHHHHHHHHHHHHHHHHccccccc

*****W**KLSPKVDC*HEYSKSVKKLTITPH**************************************************************************GVIPEIVTNRMISRIGFTVGIPLLVGLLFFPFFYYLKVVLKIDVPSWLPVIVSFIFFGAALLGVNYGIVSSSWDPLREGSLLGWNEAQRNWPVFWQSLW********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein PAM68, chloroplastic	Involved in early steps in photosystem II (PSII) biogenesis and in maturation and stability of newly synthesized psbA protein.	probable	O49668

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted