Citrus Sinensis ID: 028133


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MASMIVASSNAKPLSPLPITSQSPKPRIQIPQIKIPQKLLKLSSSALKSLSAVAVTSLAFSPPSLAAEIEKAALFDFNLTLPIIMVEFLVLMFALDKIYYSPLGNFMDERDNAIKEKLNSVKDTSEEVKQLEEQAAAVMRAARAEISAALTKMKKETQLEVEQKLAVGRKKIEAELQEALANLERQKEDTIKSLDSQIAALSEEIVRKVLPVQ
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
**************************************LL******LKSLSAVAVTSLAFSPPSLAAEIEKAALFDFNLTLPIIMVEFLVLMFALDKIYYSPLGNFMDERDN******************************************************************************I*SLDSQIAALSEEIVRKVLP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASMIVASSNAKPLSPLPITSQSPKPRIQIPQIKIPQKLLKLSSSALKSLSAVAVTSLAFSPPSLAAEIEKAALFDFNLTLPIIMVEFLVLMFALDKIYYSPLGNFMDERDNAxxxxxxxxxxxxxxxxxxxxxxxxxxxxARAEISAALTKMKKETQLEVEQKLAVGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVRKVLPVQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP synthase subunit b', chloroplastic Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0). The b'-subunit is a diverged and duplicated form of b found in plants and photosynthetic bacteria.probableP31853

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V6I, chain B
Confidence level:probable
Coverage over the Query: 198-210
View the alignment between query and template
View the model in PyMOL
Template: 2CLY, chain A
Confidence level:probable
Coverage over the Query: 104-130
View the alignment between query and template
View the model in PyMOL