Citrus Sinensis ID: 028152

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MQLKLVPNNSAGTVTAYYLKSPGASWDEIDFEFLGNLSGNPYIVHTNVYTQGKGDREQQFYLWFDLTADFHTYSILWNPGHIVFYIDGRPIREFKNLESFGIPYPKKQSMRMYASLWNADDWATRGGLAKTDWSQAPFTASFRNFNAKACVWSIGISSCSLNPTTKNTWFSQELDSSSQRKLKWVQQNYMVYNYCTDTSRFPQGLPQECTNKN
cCEEEEccccccEEEEEEECcccccccEEEEEEEcccccccEEEEEEEEEccccccCEEEEEccccccccEEEEEEEcccEEEEEEccCEEEEECccccccccccccccEEEEEEEEccccccccccCEECccccccEEEEEEEEEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHccEEEEECcccccccccccccccccc
*QL*L**NNSAGTVTAYYLKSPGASWDEIDFEFLGNLSGNPYIVHTNVYTQGKGDREQQFYLWFDLTADFHTYSILWNPGHIVFYIDGRPIREFKNLESFGIPYPKKQSMRMYASLWNADDWATRGGLAKTDWSQAPFTASFRNFNAKACVWSIGIS**********TWF*****SSSQRKLKWVQQNYMVYNYCTDTSRFPQGLPQE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLKLVPNNSAGTVTAYYLKSPGASWDEIDFEFLGNLSGNPYIVHTNVYTQGKGDREQQFYLWFDLTADFHTYSILWNPGHIVFYIDGRPIREFKNLESFGIPYPKKQSMRMYASLWNADDWATRGGLAKTDWSQAPFTASFRNFNAKACVWSIGISSCSLNPTTKNTWFSQELDSSSQRKLKWVQQNYMVYNYCTDTSRFPQGLPQECTNKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Xyloglucan endotransglucosylase/hydrolase protein 22 Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues. Its induction in case of mechanical stress, suggests that it may contribute in the adaptive changes in morphogenesis by being recruited to alter tissues tensil strength, or flexibility, enabling adaptation to mechanically stresssul environments.probableQ38857

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMZ, chain A
Confidence level:very confident
Coverage over the Query: 1-211
View the alignment between query and template
View the model in PyMOL