Citrus Sinensis ID: 028154

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---

MDKFLLNARHALHCLVSGCDGGDLLDGDDGSVWGGSNEEFDIETDLDREWQRRRDQFHTIGYRDGLLAGKETSAQEGFNMGFKESFHSGYNWGLVRGVTSALVCLPNELKEMLIETQEKRNKFQSLYESVHSLSTTDALKLFHDDILTKKAVEQSEGAEGGSNVTGLQNQSSDRSRLENHFGELESIILETPAIQVHLEVQKYLVSLCNDIGK

ccHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHcHHHHHHHHHHHHHcc

**KFLLNARHALHCLVSGCDGGDLLDGDDGSVWGGSNEEFDIETDLDREWQRRRDQFHTIGYRDGLLAGKETSAQEGFNMGFKESFHSGYNWGLVRGVTSALVCLPNELKEMLIETQEKRNKFQSLYESVHSLSTTDALKLFHDDILT********************************FGELESIILETPAIQVHLEVQKYLVSLCNDI**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted