Citrus Sinensis ID: 028161
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 212 | 2.2.26 [Sep-21-2011] | |||||||
| Q948P6 | 256 | Ferritin-3, chloroplastic | yes | no | 0.75 | 0.621 | 0.792 | 4e-69 | |
| Q96540 | 254 | Ferritin-1, chloroplastic | N/A | no | 0.726 | 0.606 | 0.779 | 2e-68 | |
| Q8H1T3 | 259 | Ferritin-2, chloroplastic | N/A | no | 0.740 | 0.606 | 0.764 | 1e-67 | |
| Q39101 | 255 | Ferritin-1, chloroplastic | yes | no | 0.712 | 0.592 | 0.774 | 7e-67 | |
| O65100 | 256 | Ferritin-3, chloroplastic | N/A | no | 0.75 | 0.621 | 0.742 | 8e-67 | |
| Q41709 | 250 | Ferritin-2, chloroplastic | N/A | no | 0.698 | 0.592 | 0.824 | 2e-66 | |
| Q948P5 | 247 | Ferritin-4, chloroplastic | no | no | 0.768 | 0.659 | 0.759 | 5e-66 | |
| Q94FY2 | 250 | Ferritin, chloroplastic O | N/A | no | 0.910 | 0.772 | 0.618 | 8e-66 | |
| P19976 | 250 | Ferritin-1, chloroplastic | no | no | 0.910 | 0.772 | 0.618 | 8e-66 | |
| Q8RX97 | 251 | Ferritin-1, chloroplastic | N/A | no | 0.731 | 0.617 | 0.754 | 6e-65 |
| >sp|Q948P6|FRI3_SOYBN Ferritin-3, chloroplastic OS=Glycine max PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 260 bits (665), Expect = 4e-69, Method: Compositional matrix adjust.
Identities = 126/159 (79%), Positives = 138/159 (86%)
Query: 45 RSLKVSAAVDANSMPLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQIN 104
++L A D N+ PLTGVVF+PFEEVKKE+ VP P SLARQKY D+CEA INEQIN
Sbjct: 39 KNLVPCATKDTNNRPLTGVVFEPFEEVKKELDLVPTVPQASLARQKYTDDCEATINEQIN 98
Query: 105 VEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSI 164
VEYNVSYVYHA++AYFDRDN+AL+GLAKFFKESSEEEREHAEK MEYQN RGGKVKL SI
Sbjct: 99 VEYNVSYVYHAMFAYFDRDNVALKGLAKFFKESSEEEREHAEKLMEYQNKRGGKVKLQSI 158
Query: 165 MQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSV 203
+ P SEFDH EKGDALYAMELALSLEKLTNEKLL+LHSV
Sbjct: 159 VMPLSEFDHEEKGDALYAMELALSLEKLTNEKLLNLHSV 197
|
Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Glycine max (taxid: 3847) EC: 1EC: .EC: 1EC: 6EC: .EC: 3EC: .EC: 1 |
| >sp|Q96540|FRI1_BRANA Ferritin-1, chloroplastic OS=Brassica napus GN=LSC30 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8H1T3|FRI2_TOBAC Ferritin-2, chloroplastic OS=Nicotiana tabacum GN=FER2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q39101|FRI1_ARATH Ferritin-1, chloroplastic OS=Arabidopsis thaliana GN=FER1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O65100|FRI3_VIGUN Ferritin-3, chloroplastic OS=Vigna unguiculata PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q41709|FRI2_VIGUN Ferritin-2, chloroplastic OS=Vigna unguiculata GN=PFE2 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q948P5|FRI4_SOYBN Ferritin-4, chloroplastic OS=Glycine max PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q94FY2|FRI_MALXI Ferritin, chloroplastic OS=Malus xiaojinensis PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P19976|FRI1_SOYBN Ferritin-1, chloroplastic OS=Glycine max PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|Q8RX97|FRI1_TOBAC Ferritin-1, chloroplastic OS=Nicotiana tabacum GN=FER1 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 212 | ||||||
| 327187676 | 265 | ferritin [Tamarix androssowii] | 0.924 | 0.739 | 0.694 | 6e-69 | |
| 255571441 | 253 | ferritin, plant, putative [Ricinus commu | 0.872 | 0.731 | 0.661 | 1e-68 | |
| 156118336 | 263 | ferritin [Solanum tuberosum] | 0.849 | 0.684 | 0.719 | 3e-68 | |
| 312282781 | 253 | unnamed protein product [Thellungiella h | 0.792 | 0.664 | 0.745 | 6e-68 | |
| 396075510 | 254 | ferritin 1 [Brassica rapa subsp. pekinen | 0.726 | 0.606 | 0.785 | 9e-68 | |
| 224091042 | 261 | predicted protein [Populus trichocarpa] | 0.915 | 0.743 | 0.678 | 2e-67 | |
| 224109256 | 264 | predicted protein [Populus trichocarpa] | 0.952 | 0.765 | 0.669 | 2e-67 | |
| 351723695 | 256 | ferritin-3, chloroplastic [Glycine max] | 0.75 | 0.621 | 0.792 | 2e-67 | |
| 222160692 | 254 | ferritin [Brassica juncea] | 0.726 | 0.606 | 0.785 | 2e-67 | |
| 89276793 | 265 | iron-binding protein [Pyrus pyrifolia] | 0.783 | 0.626 | 0.742 | 4e-67 |
| >gi|327187676|dbj|BAK09173.1| ferritin [Tamarix androssowii] | Back alignment and taxonomy information |
|---|
Score = 265 bits (678), Expect = 6e-69, Method: Compositional matrix adjust.
Identities = 141/203 (69%), Positives = 158/203 (77%), Gaps = 7/203 (3%)
Query: 2 ALAASSSSSLAAKQLAGLITSSSCYTKSTASLVKLGCISPRTKRSLKVSA-AVDANSMPL 60
A AAS+ S AA +T + + S V+ SP R L VSA A +AN+ PL
Sbjct: 6 AAAASTFSYFAATSAENQVTCAQSLSGS----VRFS--SPSNGRRLVVSASAPEANNRPL 59
Query: 61 TGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVSYVYHALYAYF 120
TGVVF+PFEEVKKE+ VP P +SLARQK+ DECEAAINEQINVEYNVSYVYHA+YAYF
Sbjct: 60 TGVVFKPFEEVKKELQMVPTLPQVSLARQKFVDECEAAINEQINVEYNVSYVYHAMYAYF 119
Query: 121 DRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGDAL 180
DRDN+AL+GLAKFFKESS EEREHAEK MEYQN RGG+VKL SI+ P SEFDH EKGDAL
Sbjct: 120 DRDNVALKGLAKFFKESSLEEREHAEKLMEYQNKRGGRVKLQSIVMPLSEFDHMEKGDAL 179
Query: 181 YAMELALSLEKLTNEKLLSLHSV 203
YAMELALSLEKLTNEKLL+LH V
Sbjct: 180 YAMELALSLEKLTNEKLLNLHHV 202
|
Source: Tamarix androssowii Species: Tamarix androssowii Genus: Tamarix Family: Tamaricaceae Order: Caryophyllales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255571441|ref|XP_002526668.1| ferritin, plant, putative [Ricinus communis] gi|223533968|gb|EEF35690.1| ferritin, plant, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|156118336|gb|ABU49726.1| ferritin [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|312282781|dbj|BAJ34256.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|396075510|gb|AFN81242.1| ferritin 1 [Brassica rapa subsp. pekinensis] | Back alignment and taxonomy information |
|---|
| >gi|224091042|ref|XP_002309156.1| predicted protein [Populus trichocarpa] gi|118488573|gb|ABK96099.1| unknown [Populus trichocarpa] gi|222855132|gb|EEE92679.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224109256|ref|XP_002315139.1| predicted protein [Populus trichocarpa] gi|118489975|gb|ABK96784.1| unknown [Populus trichocarpa x Populus deltoides] gi|222864179|gb|EEF01310.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351723695|ref|NP_001237032.1| ferritin-3, chloroplastic [Glycine max] gi|29839387|sp|Q948P6.1|FRI3_SOYBN RecName: Full=Ferritin-3, chloroplastic; AltName: Full=SFerH-3; Flags: Precursor gi|15487307|dbj|BAB64536.1| ferritin [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|222160692|gb|ACM47495.1| ferritin [Brassica juncea] | Back alignment and taxonomy information |
|---|
| >gi|89276793|gb|ABD66595.1| iron-binding protein [Pyrus pyrifolia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 212 | ||||||
| TAIR|locus:2149755 | 255 | FER1 "ferretin 1" [Arabidopsis | 0.75 | 0.623 | 0.625 | 3.7e-48 | |
| TAIR|locus:2063104 | 259 | FER4 "ferritin 4" [Arabidopsis | 0.721 | 0.590 | 0.633 | 3.8e-46 | |
| TAIR|locus:2078481 | 259 | FER3 "ferritin 3" [Arabidopsis | 0.872 | 0.714 | 0.557 | 6.2e-46 | |
| TAIR|locus:2074683 | 253 | FER2 "ferritin 2" [Arabidopsis | 0.768 | 0.644 | 0.603 | 3.4e-45 | |
| WB|WBGene00001501 | 170 | ftn-2 [Caenorhabditis elegans | 0.528 | 0.658 | 0.456 | 7.2e-20 | |
| UNIPROTKB|Q9TYS3 | 170 | ftn-2 "Ferritin" [Caenorhabdit | 0.528 | 0.658 | 0.456 | 7.2e-20 | |
| WB|WBGene00001500 | 170 | ftn-1 [Caenorhabditis elegans | 0.533 | 0.664 | 0.427 | 1.1e-18 | |
| UNIPROTKB|O16453 | 170 | ftn-1 "Protein FTN-1" [Caenorh | 0.533 | 0.664 | 0.427 | 1.1e-18 | |
| UNIPROTKB|F1NL14 | 209 | FTH1 "Ferritin" [Gallus gallus | 0.528 | 0.535 | 0.431 | 9.5e-18 | |
| UNIPROTKB|P08267 | 180 | FTH "Ferritin heavy chain" [Ga | 0.528 | 0.622 | 0.431 | 9.5e-18 |
| TAIR|locus:2149755 FER1 "ferretin 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 503 (182.1 bits), Expect = 3.7e-48, P = 3.7e-48
Identities = 100/160 (62%), Positives = 117/160 (73%)
Query: 45 RSLKVSAA-VDANSMPLTGVVFQPFEEVKKEXXXXXXXXXXXXARQKYEDECEAAINEQI 103
R++ V+AA VD N+MP+TGVVFQPFEEVKK ARQ++ D EA INEQI
Sbjct: 43 RAVVVAAATVDTNNMPMTGVVFQPFEEVKKADLAIPITSHASLARQRFADASEAVINEQI 102
Query: 104 NVEYNVSYVYHALYAYFDRDNIALRGLXXXXXXXXXXXXXXXXXXMEYQNLRGGKVKLHS 163
NVEYNVSYVYH++YAYFDRDN+A++GL MEYQN RGG+VKLH
Sbjct: 103 NVEYNVSYVYHSMYAYFDRDNVAMKGLAKFFKESSEEERGHAEKFMEYQNQRGGRVKLHP 162
Query: 164 IMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSV 203
I+ P SEF+HAEKGDALYAMELALSLEKLTNEKLL++H V
Sbjct: 163 IVSPISEFEHAEKGDALYAMELALSLEKLTNEKLLNVHKV 202
|
|
| TAIR|locus:2063104 FER4 "ferritin 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078481 FER3 "ferritin 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074683 FER2 "ferritin 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00001501 ftn-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9TYS3 ftn-2 "Ferritin" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00001500 ftn-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O16453 ftn-1 "Protein FTN-1" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NL14 FTH1 "Ferritin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P08267 FTH "Ferritin heavy chain" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q39101 | FRI1_ARATH | 1, ., 1, 6, ., 3, ., 1 | 0.7748 | 0.7122 | 0.5921 | yes | no |
| Q948P6 | FRI3_SOYBN | 1, ., 1, 6, ., 3, ., 1 | 0.7924 | 0.75 | 0.6210 | yes | no |
| O65100 | FRI3_VIGUN | 1, ., 1, 6, ., 3, ., 1 | 0.7421 | 0.75 | 0.6210 | N/A | no |
| Q96540 | FRI1_BRANA | 1, ., 1, 6, ., 3, ., 1 | 0.7792 | 0.7264 | 0.6062 | N/A | no |
| Q8RX97 | FRI1_TOBAC | 1, ., 1, 6, ., 3, ., 1 | 0.7548 | 0.7311 | 0.6175 | N/A | no |
| Q8H1T3 | FRI2_TOBAC | 1, ., 1, 6, ., 3, ., 1 | 0.7643 | 0.7405 | 0.6061 | N/A | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.16.3.1 | 0.946 |
| 3rd Layer | 1.16.3 | 0.963 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | estExt_fgenesh4_pg.C_LG_X1643 | hypothetical protein (265 aa) | |||||||||
(Populus trichocarpa) | |||||||||||
 | gw1.VI.1271.1 | • | • | 0.900 | |||||||
 | eugene3.01350026 | • | 0.899 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 212 | |||
| cd01056 | 161 | cd01056, Euk_Ferritin, eukaryotic ferritins | 2e-50 | |
| cd00904 | 160 | cd00904, Ferritin, Ferritin iron storage proteins | 8e-34 | |
| pfam00210 | 142 | pfam00210, Ferritin, Ferritin-like domain | 7e-25 | |
| cd01055 | 156 | cd01055, Nonheme_Ferritin, nonheme-containing ferr | 8e-23 | |
| COG1528 | 167 | COG1528, Ftn, Ferritin-like protein [Inorganic ion | 1e-15 | |
| cd00657 | 130 | cd00657, Ferritin_like, Ferritin-like superfamily | 6e-04 |
| >gnl|CDD|153114 cd01056, Euk_Ferritin, eukaryotic ferritins | Back alignment and domain information |
|---|
Score = 160 bits (408), Expect = 2e-50
Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 4/112 (3%)
Query: 93 DECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQ 152
+ECEAA+N+QIN+E N SYVY ++ AYFDRD++AL G AKFF++ S+EEREHAEK ++YQ
Sbjct: 2 EECEAALNKQINLELNASYVYLSMAAYFDRDDVALPGFAKFFRKLSDEEREHAEKLIKYQ 61
Query: 153 NLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVI 204
N RGG+V L I +P + E G L A+ELAL LEKL N+ LL LH +
Sbjct: 62 NKRGGRVVLQDIKKP----EKDEWGSGLEALELALDLEKLVNQSLLDLHKLA 109
|
Eukaryotic Ferritin (Euk_Ferritin) domain. Ferritins are the primary iron storage proteins of most living organisms and members of a broad superfamily of ferritin-like diiron-carboxylate proteins. The iron-free (apoferritin) ferritin molecule is a protein shell composed of 24 protein chains arranged in 432 symmetry. Iron storage involves the uptake of iron (II) at the protein shell, its oxidation by molecular oxygen at the dinuclear ferroxidase centers, and the movement of iron (III) into the cavity for deposition as ferrihydrite; the protein shell can hold up to 4500 iron atoms. In vertebrates, two types of chains (subunits) have been characterized, H or M (fast) and L (slow), which differ in rates of iron uptake and mineralization. Fe(II) oxidation in the H/M subunits take place initially at the ferroxidase center, a carboxylate-bridged diiron center, located within the subunit four-helix bundle. In a complementary role, negatively charged residues on the protein shell inner surface of the L subunits promote ferrihydrite nucleation. Most plant ferritins combine both oxidase and nucleation functions in one chain: they have four interior glutamate residues as well as seven ferroxidase center residues. Length = 161 |
| >gnl|CDD|153098 cd00904, Ferritin, Ferritin iron storage proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215791 pfam00210, Ferritin, Ferritin-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|153113 cd01055, Nonheme_Ferritin, nonheme-containing ferritins | Back alignment and domain information |
|---|
| >gnl|CDD|224445 COG1528, Ftn, Ferritin-like protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|153097 cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 212 | |||
| PRK15022 | 167 | ferritin-like protein; Provisional | 100.0 | |
| KOG2332 | 178 | consensus Ferritin [Inorganic ion transport and me | 100.0 | |
| cd00904 | 160 | Ferritin Ferritin iron storage proteins. Ferritins | 100.0 | |
| PRK10304 | 165 | ferritin; Provisional | 99.98 | |
| cd01056 | 161 | Euk_Ferritin eukaryotic ferritins. Eukaryotic Ferr | 99.97 | |
| COG1528 | 167 | Ftn Ferritin-like protein [Inorganic ion transport | 99.96 | |
| cd01055 | 156 | Nonheme_Ferritin nonheme-containing ferritins. Non | 99.94 | |
| PRK10635 | 158 | bacterioferritin; Provisional | 99.89 | |
| TIGR00754 | 157 | bfr bacterioferritin. Bacterioferritin is a homomu | 99.86 | |
| cd00907 | 153 | Bacterioferritin Bacterioferritin, ferritin-like d | 99.8 | |
| PF00210 | 142 | Ferritin: Ferritin-like domain; InterPro: IPR00833 | 99.76 | |
| cd01041 | 134 | Rubrerythrin Rubrerythrin, ferritin-like diiron-bi | 99.76 | |
| COG2193 | 157 | Bfr Bacterioferritin (cytochrome b1) [Inorganic io | 99.71 | |
| cd01052 | 148 | DPSL DPS-like protein, ferritin-like diiron-bindin | 99.67 | |
| cd01046 | 123 | Rubrerythrin_like rubrerythrin-like, diiron-bindin | 99.62 | |
| PRK13456 | 186 | DNA protection protein DPS; Provisional | 99.16 | |
| cd00657 | 130 | Ferritin_like Ferritin-like superfamily of diiron- | 98.75 | |
| cd01043 | 139 | DPS DPS protein, ferritin-like diiron-binding doma | 98.69 | |
| cd07908 | 154 | Mn_catalase_like Manganese catalase-like protein, | 98.65 | |
| cd01045 | 139 | Ferritin_like_AB Uncharacterized family of ferriti | 98.23 | |
| PF02915 | 137 | Rubrerythrin: Rubrerythrin; InterPro: IPR003251 Ru | 98.01 | |
| cd01051 | 156 | Mn_catalase Manganese catalase, ferritin-like diir | 97.9 | |
| COG1633 | 176 | Uncharacterized conserved protein [Function unknow | 97.34 | |
| PRK09448 | 162 | DNA starvation/stationary phase protection protein | 97.2 | |
| cd01044 | 125 | Ferritin_CCC1_N Ferritin-CCC1, N-terminal ferritin | 97.01 | |
| COG2406 | 172 | Protein distantly related to bacterial ferritins [ | 96.7 | |
| PF13668 | 137 | Ferritin_2: Ferritin-like domain | 96.6 | |
| COG1592 | 166 | Rubrerythrin [Energy production and conversion] | 96.52 | |
| COG0783 | 156 | Dps DNA-binding ferritin-like protein (oxidative d | 95.97 | |
| PF09537 | 111 | DUF2383: Domain of unknown function (DUF2383); Int | 95.84 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 94.63 | |
| TIGR02284 | 139 | conserved hypothetical protein. Members of this pr | 94.52 | |
| cd01048 | 135 | Ferritin_like_AB2 Uncharacterized family of ferrit | 93.45 | |
| cd01042 | 165 | DMQH Demethoxyubiquinone hydroxylase, ferritin-lik | 91.95 | |
| PF03232 | 172 | COQ7: Ubiquinone biosynthesis protein COQ7; InterP | 84.98 | |
| PF12902 | 227 | Ferritin-like: Ferritin-like; PDB: 3HL1_A. | 83.93 | |
| cd01041 | 134 | Rubrerythrin Rubrerythrin, ferritin-like diiron-bi | 83.82 | |
| cd01046 | 123 | Rubrerythrin_like rubrerythrin-like, diiron-bindin | 83.67 | |
| cd07910 | 180 | MiaE MiaE tRNA-modifying nonheme diiron monooxygen | 83.65 |
| >PRK15022 ferritin-like protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.3e-34 Score=238.14 Aligned_cols=112 Identities=15% Similarity=0.207 Sum_probs=105.9
Q ss_pred cccHHHHHHHHhhhhhhhhHHHHHHHHHHhhccCccchhhHHHHHHHHHHHHHHHHHHHHHHHHhcCCeeeeccccCCCC
Q 028161 90 KYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPS 169 (212)
Q Consensus 90 ~~s~e~e~aLNeQIn~EL~ASy~YLsmAa~Fdrd~vgL~GfAkfFr~qS~EEreHAekLikY~n~RGG~V~l~~I~~P~~ 169 (212)
|.+++++.+||+|||.|++|||+|++||+||+ +.+|||||+||+.||+|||+||+||++||++|||+|.+++|++|+.
T Consensus 1 m~~~~~~~~LN~QIn~E~~aSy~YLsMa~~~~--~~~L~GfA~ff~~qa~EEreHA~k~~~yl~~rGg~v~l~~I~~P~~ 78 (167)
T PRK15022 1 MATAGMLLKLNSQMNLEFYASNLYLHLSEWCS--EQSLNGTATFLRAQAQSNVTQMMRMFNFMKSAGATPIVKAIDVPGE 78 (167)
T ss_pred CchHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--hCCChhHHHHHHHHHHHHHHHHHHHHHHHHHcCCceeeCCCCCCcc
Confidence 46789999999999999999999999999998 5699999999999999999999999999999999999999999986
Q ss_pred CCCccccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Q 028161 170 EFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVICLYH 208 (212)
Q Consensus 170 ~f~~~e~~d~lealE~AL~lEK~vt~~L~~L~~lA~~~~ 208 (212)
+ |++++++|+.+|+|||.||+.|++|+++|.+++
T Consensus 79 ~-----~~s~~e~fe~al~hEk~vt~~I~~L~~~A~~~~ 112 (167)
T PRK15022 79 K-----LNSLEELFQKTLEEYEQRSSTLAQLADEAKALN 112 (167)
T ss_pred c-----cCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcC
Confidence 5 456899999999999999999999999998765
|
|
| >KOG2332 consensus Ferritin [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00904 Ferritin Ferritin iron storage proteins | Back alignment and domain information |
|---|
| >PRK10304 ferritin; Provisional | Back alignment and domain information |
|---|
| >cd01056 Euk_Ferritin eukaryotic ferritins | Back alignment and domain information |
|---|
| >COG1528 Ftn Ferritin-like protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01055 Nonheme_Ferritin nonheme-containing ferritins | Back alignment and domain information |
|---|
| >PRK10635 bacterioferritin; Provisional | Back alignment and domain information |
|---|
| >TIGR00754 bfr bacterioferritin | Back alignment and domain information |
|---|
| >cd00907 Bacterioferritin Bacterioferritin, ferritin-like diiron-binding domain | Back alignment and domain information |
|---|
| >PF00210 Ferritin: Ferritin-like domain; InterPro: IPR008331 Ferritin is one of the major non-haem iron storage proteins in animals, plants, and microorganisms [] | Back alignment and domain information |
|---|
| >cd01041 Rubrerythrin Rubrerythrin, ferritin-like diiron-binding domain | Back alignment and domain information |
|---|
| >COG2193 Bfr Bacterioferritin (cytochrome b1) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01052 DPSL DPS-like protein, ferritin-like diiron-binding domain | Back alignment and domain information |
|---|
| >cd01046 Rubrerythrin_like rubrerythrin-like, diiron-binding domain | Back alignment and domain information |
|---|
| >PRK13456 DNA protection protein DPS; Provisional | Back alignment and domain information |
|---|
| >cd00657 Ferritin_like Ferritin-like superfamily of diiron-containing four-helix-bundle proteins | Back alignment and domain information |
|---|
| >cd01043 DPS DPS protein, ferritin-like diiron-binding domain | Back alignment and domain information |
|---|
| >cd07908 Mn_catalase_like Manganese catalase-like protein, ferritin-like diiron-binding domain | Back alignment and domain information |
|---|
| >cd01045 Ferritin_like_AB Uncharacterized family of ferritin-like proteins found in archaea and bacteria | Back alignment and domain information |
|---|
| >PF02915 Rubrerythrin: Rubrerythrin; InterPro: IPR003251 Rubrerythrin (Rr), found in anaerobic sulphate-reducing bacteria [], is a fusion protein containing an N-terminal diiron-binding domain and a C-terminal domain homologous to rubredoxin [] | Back alignment and domain information |
|---|
| >cd01051 Mn_catalase Manganese catalase, ferritin-like diiron-binding domain | Back alignment and domain information |
|---|
| >COG1633 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09448 DNA starvation/stationary phase protection protein Dps; Provisional | Back alignment and domain information |
|---|
| >cd01044 Ferritin_CCC1_N Ferritin-CCC1, N-terminal ferritin-like diiron-binding domain | Back alignment and domain information |
|---|
| >COG2406 Protein distantly related to bacterial ferritins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13668 Ferritin_2: Ferritin-like domain | Back alignment and domain information |
|---|
| >COG1592 Rubrerythrin [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0783 Dps DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF09537 DUF2383: Domain of unknown function (DUF2383); InterPro: IPR019052 This entry represents a functionally uncharacterised ferritin like domain | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02284 conserved hypothetical protein | Back alignment and domain information |
|---|
| >cd01048 Ferritin_like_AB2 Uncharacterized family of ferritin-like proteins found in archaea and bacteria | Back alignment and domain information |
|---|
| >cd01042 DMQH Demethoxyubiquinone hydroxylase, ferritin-like diiron-binding domain | Back alignment and domain information |
|---|
| >PF03232 COQ7: Ubiquinone biosynthesis protein COQ7; InterPro: IPR011566 Coq7 (also known as Clk-1) is a di-iron carboxylate protein occuring in both prokaryotes and eukaryotes that is essential for ubiquinone biosynthesis [, ] | Back alignment and domain information |
|---|
| >PF12902 Ferritin-like: Ferritin-like; PDB: 3HL1_A | Back alignment and domain information |
|---|
| >cd01041 Rubrerythrin Rubrerythrin, ferritin-like diiron-binding domain | Back alignment and domain information |
|---|
| >cd01046 Rubrerythrin_like rubrerythrin-like, diiron-binding domain | Back alignment and domain information |
|---|
| >cd07910 MiaE MiaE tRNA-modifying nonheme diiron monooxygenase, ferritin-like diiron-binding domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 212 | ||||
| 3a9q_A | 212 | Crystal Structure Analysis Of E173a Variant Of The | 6e-51 | ||
| 3a68_A | 212 | Crystal Structure Of Plant Ferritin Reveals A Novel | 7e-51 | ||
| 3vnx_A | 204 | Crystal Structure Of Ferritin From Multicellular Gr | 3e-32 | ||
| 3sh6_A | 176 | Frog M-Ferritin, D122r Mutant, With Magnesium Lengt | 2e-19 | ||
| 3ka8_A | 176 | Frog M-Ferritin, Eqh Mutant, With Cobalt Length = 1 | 2e-19 | ||
| 3ka9_A | 176 | Frog M-Ferritin, Eeh Mutant, With Cobalt Length = 1 | 2e-19 | ||
| 1mfr_A | 176 | Crystal Structure Of M Ferritin Length = 176 | 2e-19 | ||
| 3shx_A | 176 | Frog M-Ferritin With Magnesium, L134p Mutant Length | 2e-19 | ||
| 3ka6_A | 176 | Frog M-Ferritin, Eed Mutant, With Cobalt Length = 1 | 2e-19 | ||
| 3se1_A | 176 | Frog M-Ferritin With Magnesium, R72d Mutant Length | 2e-18 | ||
| 3es3_A | 183 | Directing Noble Metal Ion Chemistry Within A Design | 6e-17 | ||
| 1bg7_A | 176 | Localized Unfolding At The Junction Of Three Ferrit | 7e-17 | ||
| 3erz_A | 183 | Directing Noble Metal Ion Chemistry Within A Design | 9e-17 | ||
| 2z6m_A | 176 | Crystal Structure Of Human Ferritin H8 As Biotempla | 1e-16 | ||
| 1rcc_A | 173 | Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Lengt | 1e-16 | ||
| 2cei_A | 183 | Recombinant Human H Ferritin, K86q Mutant, Soaked W | 2e-16 | ||
| 4dyx_A | 172 | Crystal Structure Of The Cu-adduct Of Human H-ferri | 2e-16 | ||
| 3ajo_A | 182 | Crystal Structure Of Wild-Type Human Ferritin H Cha | 2e-16 | ||
| 3ajq_A | 182 | Crystal Structure Of Human H Ferritin E140q Mutant | 2e-16 | ||
| 3ajp_A | 182 | Crystal Structure Of Human H Ferritin E140a Mutant | 2e-16 | ||
| 1rcd_A | 173 | Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Lengt | 2e-16 | ||
| 2chi_A | 183 | Recombinant Human H Ferritin, K86q And E27d Mutant | 3e-16 | ||
| 2clu_A | 183 | Recombinant Human H Ferritin, K86q And E107d Mutant | 3e-16 | ||
| 1rci_A | 173 | Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Lengt | 6e-16 | ||
| 1r03_A | 182 | Crystal Structure Of A Human Mitochondrial Ferritin | 6e-16 | ||
| 2cn7_A | 183 | Recombinant Human H Ferritin, K86q, E27d And E107d | 7e-16 | ||
| 4dyy_A | 172 | Crystal Structure Of The Cu-adduct Of Human H-ferri | 8e-15 | ||
| 1h96_A | 182 | Recombinant Mouse L-Chain Ferritin Length = 182 | 9e-15 | ||
| 4dz0_A | 172 | Crystal Structure Of The Cu-adduct Of Human H-ferri | 1e-14 | ||
| 3af9_X | 174 | Crystal Structure Of Pd(Allyl)APO-C48afr Length = 1 | 1e-13 | ||
| 2zur_X | 174 | Crystal Structure Of Rh(Nbd)APO-Fr Length = 174 | 1e-13 | ||
| 2gyd_A | 170 | Complex Of Equine Apoferritin With The H-Diaziflura | 2e-13 | ||
| 1ies_A | 174 | Tetragonal Crystal Structure Of Native Horse Spleen | 2e-13 | ||
| 3af8_X | 174 | Crystal Structure Of Pd(Ally)APO-C126afr Length = 1 | 2e-13 | ||
| 3np2_X | 174 | Crystal Structure Of Pd(Allyl)APO-E45cC48A-Rhlfr Le | 3e-13 | ||
| 3np0_X | 174 | Crystal Structure Of Pd(Allyl)APO-E45cH49AR52H-Rhlf | 4e-13 | ||
| 3hx2_A | 192 | Crystal Structure Of Human Ferritin Phe167serfsx26 | 4e-13 | ||
| 3kxu_A | 191 | Crystal Structure Of Human Ferritin Ftl498instc Pat | 4e-13 | ||
| 3noz_X | 174 | Crystal Structure Of Pd(Allyl)APO-E45cR52H-Rhlfr Le | 5e-13 | ||
| 2v2p_A | 174 | Mutant (E53,56,57,60q And R59m) Recombinant Horse S | 7e-13 | ||
| 2v2l_A | 174 | Mutant (E53,56,57,60q) Recombinant Horse Spleen Apo | 7e-13 | ||
| 2fg4_A | 174 | Structure Of Human Ferritin L Chain Length = 174 | 8e-13 | ||
| 2ffx_J | 173 | Structure Of Human Ferritin L. Chain Length = 173 | 8e-13 | ||
| 2zg8_X | 174 | Crystal Structure Of Pd(Allyl)APO-H49afr Length = 1 | 1e-12 | ||
| 2v2n_A | 174 | Mutant R59m Recombinant Horse Spleen Apoferritin Co | 1e-12 | ||
| 2g4h_A | 174 | Anomalous Substructure Of Apoferritin Length = 174 | 1e-12 | ||
| 2za6_A | 175 | Recombinant Horse L-Chain Apoferritin Length = 175 | 1e-12 | ||
| 2za7_A | 171 | Recombinant Horse L-Chain Apoferritin N-Terminal De | 2e-12 | ||
| 2zg9_X | 174 | Crystal Structure Of Pd(Allyl)APO-H114afr Length = | 2e-11 | ||
| 2za8_A | 167 | Recombinant Horse L-Chain Apoferritin N-Terminal De | 3e-11 | ||
| 3kx9_A | 173 | Engineering A Closed Form Of The Archaeoglobus Fulg | 2e-07 | ||
| 1s3q_A | 173 | Crystal Structures Of A Novel Open Pore Ferritin Fr | 5e-07 | ||
| 1z4a_A | 164 | Ferritin From T. Maritima Length = 164 | 6e-05 | ||
| 1vlg_A | 176 | Crystal Structure Of Ferritin (Tm1128) From Thermot | 2e-04 | ||
| 2jd6_0 | 174 | Crystal Structure Of The As Isolated Ferritin From | 6e-04 | ||
| 2x17_0 | 173 | The X-Ray Structure Of Ferritin From Pyrococcus Fur | 6e-04 |
| >pdb|3A9Q|A Chain A, Crystal Structure Analysis Of E173a Variant Of The Soybean Ferritin Sfer4 Length = 212 | Back alignment and structure |
|
| >pdb|3A68|A Chain A, Crystal Structure Of Plant Ferritin Reveals A Novel Metal Binding Site That Functions As A Transit Site For Metal Transfer In Ferritin Length = 212 | Back alignment and structure |
| >pdb|3VNX|A Chain A, Crystal Structure Of Ferritin From Multicellular Green Algae, Ulva Pertusa Length = 204 | Back alignment and structure |
| >pdb|3SH6|A Chain A, Frog M-Ferritin, D122r Mutant, With Magnesium Length = 176 | Back alignment and structure |
| >pdb|3KA8|A Chain A, Frog M-Ferritin, Eqh Mutant, With Cobalt Length = 176 | Back alignment and structure |
| >pdb|3KA9|A Chain A, Frog M-Ferritin, Eeh Mutant, With Cobalt Length = 176 | Back alignment and structure |
| >pdb|1MFR|A Chain A, Crystal Structure Of M Ferritin Length = 176 | Back alignment and structure |
| >pdb|3SHX|A Chain A, Frog M-Ferritin With Magnesium, L134p Mutant Length = 176 | Back alignment and structure |
| >pdb|3KA6|A Chain A, Frog M-Ferritin, Eed Mutant, With Cobalt Length = 176 | Back alignment and structure |
| >pdb|3SE1|A Chain A, Frog M-Ferritin With Magnesium, R72d Mutant Length = 176 | Back alignment and structure |
| >pdb|3ES3|A Chain A, Directing Noble Metal Ion Chemistry Within A Designed Ferritin Protein. The Complex With Gold Ions. Ferritin H8-H9x Mutant Length = 183 | Back alignment and structure |
| >pdb|1BG7|A Chain A, Localized Unfolding At The Junction Of Three Ferritin Subunits. A Mechanism For Iron Release? Length = 176 | Back alignment and structure |
| >pdb|3ERZ|A Chain A, Directing Noble Metal Ion Chemistry Within A Designed Ferritin Protein. Mercury Ions On The Three-Fold Channel Length = 183 | Back alignment and structure |
| >pdb|2Z6M|A Chain A, Crystal Structure Of Human Ferritin H8 As Biotemplate For Noble Metal Nanoparticle Synthesis Length = 176 | Back alignment and structure |
| >pdb|1RCC|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Length = 173 | Back alignment and structure |
| >pdb|2CEI|A Chain A, Recombinant Human H Ferritin, K86q Mutant, Soaked With Zn Length = 183 | Back alignment and structure |
| >pdb|4DYX|A Chain A, Crystal Structure Of The Cu-adduct Of Human H-ferritin Variant 4his- Delta C-star Length = 172 | Back alignment and structure |
| >pdb|3AJO|A Chain A, Crystal Structure Of Wild-Type Human Ferritin H Chain Length = 182 | Back alignment and structure |
| >pdb|3AJQ|A Chain A, Crystal Structure Of Human H Ferritin E140q Mutant Length = 182 | Back alignment and structure |
| >pdb|3AJP|A Chain A, Crystal Structure Of Human H Ferritin E140a Mutant Length = 182 | Back alignment and structure |
| >pdb|1RCD|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Length = 173 | Back alignment and structure |
| >pdb|2CHI|A Chain A, Recombinant Human H Ferritin, K86q And E27d Mutant Length = 183 | Back alignment and structure |
| >pdb|2CLU|A Chain A, Recombinant Human H Ferritin, K86q And E107d Mutant Length = 183 | Back alignment and structure |
| >pdb|1RCI|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Length = 173 | Back alignment and structure |
| >pdb|1R03|A Chain A, Crystal Structure Of A Human Mitochondrial Ferritin Length = 182 | Back alignment and structure |
| >pdb|2CN7|A Chain A, Recombinant Human H Ferritin, K86q, E27d And E107d Mutant Length = 183 | Back alignment and structure |
| >pdb|4DYY|A Chain A, Crystal Structure Of The Cu-adduct Of Human H-ferritin Variant Mic1 Length = 172 | Back alignment and structure |
| >pdb|1H96|A Chain A, Recombinant Mouse L-Chain Ferritin Length = 182 | Back alignment and structure |
| >pdb|4DZ0|A Chain A, Crystal Structure Of The Cu-adduct Of Human H-ferritin Variant Mic1 Labeled With A Dansyl Fluorophore Length = 172 | Back alignment and structure |
| >pdb|3AF9|X Chain X, Crystal Structure Of Pd(Allyl)APO-C48afr Length = 174 | Back alignment and structure |
| >pdb|2ZUR|X Chain X, Crystal Structure Of Rh(Nbd)APO-Fr Length = 174 | Back alignment and structure |
| >pdb|2GYD|A Chain A, Complex Of Equine Apoferritin With The H-Diaziflurane Photolabeling Reagent Length = 170 | Back alignment and structure |
| >pdb|1IES|A Chain A, Tetragonal Crystal Structure Of Native Horse Spleen Ferritin Length = 174 | Back alignment and structure |
| >pdb|3AF8|X Chain X, Crystal Structure Of Pd(Ally)APO-C126afr Length = 174 | Back alignment and structure |
| >pdb|3NP2|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cC48A-Rhlfr Length = 174 | Back alignment and structure |
| >pdb|3NP0|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cH49AR52H-Rhlfr Length = 174 | Back alignment and structure |
| >pdb|3HX2|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of The Biological Unit That Are Present In The Crystallographic Asymmetric Unit. The Entire Structure Contains Six Copies Of The Biological Unit In The Crystallographic Asymmetric Unit And Is Described In Remark 400 Length = 192 | Back alignment and structure |
| >pdb|3KXU|A Chain A, Crystal Structure Of Human Ferritin Ftl498instc Pathogenic M Length = 191 | Back alignment and structure |
| >pdb|3NOZ|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cR52H-Rhlfr Length = 174 | Back alignment and structure |
| >pdb|2V2P|A Chain A, Mutant (E53,56,57,60q And R59m) Recombinant Horse Spleen Apoferritin Cocrystallized With Haemin In Acidic Conditions Length = 174 | Back alignment and structure |
| >pdb|2V2L|A Chain A, Mutant (E53,56,57,60q) Recombinant Horse Spleen Apoferritin Cocrystallized With Haemin In Acidic Conditions Length = 174 | Back alignment and structure |
| >pdb|2FG4|A Chain A, Structure Of Human Ferritin L Chain Length = 174 | Back alignment and structure |
| >pdb|2FFX|J Chain J, Structure Of Human Ferritin L. Chain Length = 173 | Back alignment and structure |
| >pdb|2ZG8|X Chain X, Crystal Structure Of Pd(Allyl)APO-H49afr Length = 174 | Back alignment and structure |
| >pdb|2V2N|A Chain A, Mutant R59m Recombinant Horse Spleen Apoferritin Cocrystallized With Haemin In Acidic Conditions Length = 174 | Back alignment and structure |
| >pdb|2G4H|A Chain A, Anomalous Substructure Of Apoferritin Length = 174 | Back alignment and structure |
| >pdb|2ZA6|A Chain A, Recombinant Horse L-Chain Apoferritin Length = 175 | Back alignment and structure |
| >pdb|2ZA7|A Chain A, Recombinant Horse L-Chain Apoferritin N-Terminal Deletion Mutant (Residues 1-4) Length = 171 | Back alignment and structure |
| >pdb|2ZG9|X Chain X, Crystal Structure Of Pd(Allyl)APO-H114afr Length = 174 | Back alignment and structure |
| >pdb|2ZA8|A Chain A, Recombinant Horse L-Chain Apoferritin N-Terminal Deletion Mutant (Residues 1-8) Length = 167 | Back alignment and structure |
| >pdb|3KX9|A Chain A, Engineering A Closed Form Of The Archaeoglobus Fulgidus Ferritin By Site Directed Mutagenesis Length = 173 | Back alignment and structure |
| >pdb|1S3Q|A Chain A, Crystal Structures Of A Novel Open Pore Ferritin From The Hyperthermophilic Archaeon Archaeoglobus Fulgidus Length = 173 | Back alignment and structure |
| >pdb|1Z4A|A Chain A, Ferritin From T. Maritima Length = 164 | Back alignment and structure |
| >pdb|1VLG|A Chain A, Crystal Structure Of Ferritin (Tm1128) From Thermotoga Maritima At 2.00 A Resolution Length = 176 | Back alignment and structure |
| >pdb|2JD6|0 Chain 0, Crystal Structure Of The As Isolated Ferritin From The Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus Length = 174 | Back alignment and structure |
| >pdb|2X17|0 Chain 0, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus Loaded With Ag(I) Length = 173 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3a68_A Sferh-4, ferritin-4, chloroplastic; 4-helix bundle, iron storage, CAGE-like protein, plant, iron, metal-binding, oxidoreductase, plastid; 1.80A {Glycine max} PDB: 3a9q_A Length = 212 | Back alignment and structure |
|---|
Score = 211 bits (540), Expect = 4e-70
Identities = 120/153 (78%), Positives = 133/153 (86%)
Query: 51 AAVDANSMPLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVS 110
A N LTGV+F+PFEEVKKE+ VP P SLARQKY DE E+A+NEQINVEYNVS
Sbjct: 1 AKGSTNHRALTGVIFEPFEEVKKELDLVPTVPQASLARQKYVDESESAVNEQINVEYNVS 60
Query: 111 YVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSE 170
YVYHA++AYFDRDN+ALRGLAKFFKESSEEEREHAEK MEYQN RGGKVKL SI+ P S+
Sbjct: 61 YVYHAMFAYFDRDNVALRGLAKFFKESSEEEREHAEKLMEYQNKRGGKVKLQSIVMPLSD 120
Query: 171 FDHAEKGDALYAMELALSLEKLTNEKLLSLHSV 203
FDHA+KGDAL+AMELALSLEKLTNEKLL+LHSV
Sbjct: 121 FDHADKGDALHAMELALSLEKLTNEKLLNLHSV 153
|
| >3vnx_A Ferritin; 4-helix bundle, iron storage, oxidoreductase; 2.40A {Ulva pertusa} Length = 204 | Back alignment and structure |
|---|
| >2cih_A Ferritin heavy chain; apoferritin, ferroxidase, DI-iron non-heme protein, iron storage, iron, metal-binding, oxidoreductase, phosphorylation; 1.5A {Homo sapiens} PDB: 2chi_A 2cei_A 1fha_A 2fha_A 2cn7_A 2iu2_A 2clu_A 2cn6_A 3ajo_A 3ajq_A 3ajp_A 3erz_A 3es3_A 2z6m_A 1r03_A Length = 183 | Back alignment and structure |
|---|
| >1rcd_A L ferritin; iron storage; 2.00A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 1rcg_A 1rci_A 1rcc_A 1rce_A Length = 173 | Back alignment and structure |
|---|
| >3ka8_A Ferritin, middle subunit; iron storage, DIIRON, iron, metal-binding, oxidoreductase; 1.35A {Rana catesbeiana} PDB: 3ka9_A 3ka3_A 1mfr_A 3ka4_A 3rbc_A 3re7_A 3rgd_A 3ka6_A 3shx_A 3sh6_A 3se1_A 1bg7_A Length = 176 | Back alignment and structure |
|---|
| >1z6o_M Ferritin heavy chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Length = 191 | Back alignment and structure |
|---|
| >3oj5_A Ferritin family protein; ferroxidase, cytosol, oxidoreductase; 2.85A {Mycobacterium tuberculosis} PDB: 3qd8_A Length = 189 | Back alignment and structure |
|---|
| >3e6s_A Ferritin; iron storage, ferroxidase, oxidoreductase; 1.95A {Pseudo-nitzschia multiseries} PDB: 3e6r_A Length = 168 | Back alignment and structure |
|---|
| >1vlg_A Ferritin; TM1128, structural genomics, JCSG, protein structu initiative, PSI, joint center for structural genomics, META protein; 2.00A {Thermotoga maritima} SCOP: a.25.1.1 PDB: 1z4a_A* Length = 176 | Back alignment and structure |
|---|
| >2v2p_A Ferritin light chain; metal transport, iron, haemin, apoferritin, iron storage, metal-binding; 1.15A {Equus caballus} PDB: 2v2r_A 2v2m_A 2v2l_A 2v2s_A 2v2o_A 2v2n_A 2za6_A 2v2j_A 2v2i_A 2z5p_A 1dat_A 2g4h_A 1aew_A 3h7g_A 2zg9_X 2zg8_X 3fi6_A 3o7r_A 2w0o_A 1hrs_A* ... Length = 174 | Back alignment and structure |
|---|
| >3kxu_A Ferritin; iron storage protein, disorder, iron, metal binding protein; 1.85A {Homo sapiens} PDB: 3hx2_A 3hx5_A 3hx7_A Length = 191 | Back alignment and structure |
|---|
| >2jd6_0 Ferritin homolog, ferritin; metal transport, iron, pores, archaeon, entry channels, thermostability, hyperthermophIle, ferroxidase center; 2.75A {Pyrococcus furiosus} PDB: 2jd7_0 2jd8_0 2x17_0 Length = 174 | Back alignment and structure |
|---|
| >1s3q_A Ferritin; ferroxidase, four helix bundle, iron storage, metal binding; 2.10A {Archaeoglobus fulgidus} SCOP: a.25.1.1 PDB: 1sq3_A 3kx9_A Length = 173 | Back alignment and structure |
|---|
| >1krq_A Ferritin; H-chain like four-helix bundle, binding protein; 2.70A {Campylobacter jejuni} SCOP: a.25.1.1 Length = 167 | Back alignment and structure |
|---|
| >3qz3_A Ferritin; structural genomics, the center for structural genomics of I diseases, csgid, cytoplasmic, oxidoreductase; 2.10A {Vibrio cholerae o1 biovar el tor} Length = 184 | Back alignment and structure |
|---|
| >1eum_A Ferritin 1; ECFTNA, metal binding protein; 2.05A {Escherichia coli} SCOP: a.25.1.1 Length = 165 | Back alignment and structure |
|---|
| >1z6o_A Ferritin light chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Length = 212 | Back alignment and structure |
|---|
| >1jgc_A Bacterioferritin, BFR; iron storage protein, metal binding protein; HET: HEM; 2.60A {Rhodobacter capsulatus} SCOP: a.25.1.1 Length = 161 | Back alignment and structure |
|---|
| >3qb9_A Bacterioferritin, BFR; cytosol, structural genomics, TB structural genomics consort TBSGC, metal binding protein; HET: HEM; 2.11A {Mycobacterium tuberculosis} PDB: 2wtl_A* 3bkn_A* Length = 174 | Back alignment and structure |
|---|
| >2fkz_A Bacterioferritin; ferroxidase, DIIRON site, iron T metal binding protein; HET: HEM; 2.00A {Azotobacter vinelandii} SCOP: a.25.1.1 PDB: 2fl0_A* 1sof_A* Length = 155 | Back alignment and structure |
|---|
| >2y3q_A Bacterioferritin; metal binding protein, redox; HET: HEM; 1.55A {Escherichia coli} PDB: 1bfr_A* 1bcf_A* 2htn_A* 2vxi_A* 3e1j_A* 3e1l_A* 3e1m_A* 3e1n_A* 3e1o_A* 3e1p_A* 3ghq_A* 3e1q_A* 3e2c_A* 3isf_A* 3is8_A* 3ise_A* 3is7_A* Length = 158 | Back alignment and structure |
|---|
| >3r2k_A Bacterioferritin, BFR; bacterial ferritin, iron binding, iron storage, iron homeost iron release, iron mobilization; 1.55A {Pseudomonas aeruginosa} PDB: 3r2h_A 3r2l_A 3r2m_A 3r2o_A 3r2r_A 3r2s_A Length = 154 | Back alignment and structure |
|---|
| >3fvb_A Bacterioferritin; niaid, ssgcid, decode, structural genomics, seattle structural genomics center for infectious disease; HET: HEM; 1.81A {Brucella melitensis biovar ABORTUS2308} Length = 182 | Back alignment and structure |
|---|
| >3gvy_A Bacterioferritin; iron storage, DI-iron, ferroxida activity, heme, metal binding protein; HET: HEM; 2.80A {Rhodobacter sphaeroides} Length = 161 | Back alignment and structure |
|---|
| >1nfv_A Bacterioferritin; 24 subunits in the active molecule, DIIRON HAEM Fe-coproporphyrin III cofactor, iron storage-electron complex; HET: FEC; 1.95A {Desulfovibrio desulfuricans} SCOP: a.25.1.1 PDB: 1nf6_A* 1nf4_A* Length = 179 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 212 | |||
| 3vnx_A | 204 | Ferritin; 4-helix bundle, iron storage, oxidoreduc | 100.0 | |
| 3a68_A | 212 | Sferh-4, ferritin-4, chloroplastic; 4-helix bundle | 100.0 | |
| 3kxu_A | 191 | Ferritin; iron storage protein, disorder, iron, me | 100.0 | |
| 3ka8_A | 176 | Ferritin, middle subunit; iron storage, DIIRON, ir | 100.0 | |
| 2cih_A | 183 | Ferritin heavy chain; apoferritin, ferroxidase, DI | 100.0 | |
| 1rcd_A | 173 | L ferritin; iron storage; 2.00A {Rana catesbeiana} | 100.0 | |
| 1z6o_M | 191 | Ferritin heavy chain; metal binding protein, iron | 100.0 | |
| 2v2p_A | 174 | Ferritin light chain; metal transport, iron, haemi | 100.0 | |
| 1z6o_A | 212 | Ferritin light chain; metal binding protein, iron | 100.0 | |
| 3e6s_A | 168 | Ferritin; iron storage, ferroxidase, oxidoreductas | 99.98 | |
| 1s3q_A | 173 | Ferritin; ferroxidase, four helix bundle, iron sto | 99.97 | |
| 3uno_A | 189 | Probable bacterioferritin BFRB; ferroxidase activi | 99.97 | |
| 3qz3_A | 184 | Ferritin; structural genomics, the center for stru | 99.97 | |
| 1eum_A | 165 | Ferritin 1; ECFTNA, metal binding protein; 2.05A { | 99.97 | |
| 1krq_A | 167 | Ferritin; H-chain like four-helix bundle, binding | 99.96 | |
| 3bvf_A | 181 | Ferritin; iron storage, metal-binding, oxidoreduct | 99.95 | |
| 1vlg_A | 176 | Ferritin; TM1128, structural genomics, JCSG, prote | 99.94 | |
| 4am5_A | 159 | Bacterioferritin; metal binding protein, ferroxida | 99.94 | |
| 2jd6_0 | 174 | Ferritin homolog, ferritin; metal transport, iron, | 99.92 | |
| 3oj5_A | 189 | Ferritin family protein; ferroxidase, cytosol, oxi | 99.89 | |
| 3uoi_A | 161 | Bacterioferritin, BFR; structural genomics, TB str | 99.86 | |
| 3r2k_A | 154 | Bacterioferritin, BFR; bacterial ferritin, iron bi | 99.86 | |
| 3gvy_A | 161 | Bacterioferritin; iron storage, DI-iron, ferroxida | 99.84 | |
| 2y3q_A | 158 | Bacterioferritin; metal binding protein, redox; HE | 99.84 | |
| 3fvb_A | 182 | Bacterioferritin; niaid, ssgcid, decode, structura | 99.84 | |
| 3qb9_A | 174 | Bacterioferritin, BFR; cytosol, structural genomic | 99.83 | |
| 1nfv_A | 179 | Bacterioferritin; 24 subunits in the active molecu | 99.82 | |
| 1lko_A | 191 | Rubrerythrin all-iron(II) form; reduced form, DIIR | 99.82 | |
| 1jgc_A | 161 | Bacterioferritin, BFR; iron storage protein, metal | 99.82 | |
| 2fkz_A | 155 | Bacterioferritin; ferroxidase, DIIRON site, iron T | 99.82 | |
| 2vzb_A | 170 | Putative bacterioferritin-related protein; DPS, DP | 99.81 | |
| 1j30_A | 144 | 144AA long hypothetical rubrerythrin; sulerythrin, | 99.8 | |
| 2qqy_A | 149 | Sigma B operon; dodecameric alpha-helical, ferriti | 99.78 | |
| 2c41_A | 158 | DPS family DNA-binding stress response protein; ir | 99.77 | |
| 1ji5_A | 142 | DLP-1; dodecamer, four-helix bundle, metal transpo | 99.76 | |
| 1n1q_A | 149 | DPS protein; four-helix bundle, unknown function; | 99.72 | |
| 2vxx_A | 192 | Starvation induced DNA binding protein; stress res | 99.72 | |
| 1jig_A | 146 | DLP-2; dodecamer, four-helix bundle, metal transpo | 99.71 | |
| 2d5k_A | 156 | DPS, DPS family protein; four helix bundle, metal | 99.69 | |
| 2clb_A | 188 | DPS-like protein; DI-iron carboxylate, hypothetica | 99.67 | |
| 1yuz_A | 202 | Nigerythrin; rubrythrin, rubredoxin, hemerythrin, | 99.56 | |
| 1tjo_A | 182 | Iron-rich DPSA-homolog protein; ferritin, low-iron | 99.49 | |
| 3pwf_A | 170 | Rubrerythrin; non heme iron peroxidases, oxidative | 99.16 | |
| 2fjc_A | 156 | Antigen TPF1; mini ferritin, iron binding protein, | 99.13 | |
| 1o9r_A | 162 | Agrobacterium tumefaciens DPS; iron-binding protei | 99.13 | |
| 2chp_A | 153 | MRGA, metalloregulation DNA-binding stress protein | 99.12 | |
| 4di0_A | 144 | Rubrerythrin; ssgcid, seattle structural genomics | 99.12 | |
| 2bk6_A | 156 | Non-heme iron-containing ferritin; DPS (DNA bindin | 99.1 | |
| 2yjk_A | 161 | AFP, DPS; metal-binding protein, iron uptake, ferr | 99.08 | |
| 2c2u_A | 207 | DPS, DNA-binding stress response protein; DNA-bind | 99.04 | |
| 2z90_A | 161 | Starvation-inducible DNA-binding protein or FINE t | 99.03 | |
| 2yw6_A | 183 | DNA protection during starvation protein; DNA-bind | 98.99 | |
| 2wlu_A | 175 | DPS-like peroxide resistance protein; DNA-binding, | 98.99 | |
| 2c2j_A | 211 | DNA-binding stress response protein; DNA-binding p | 98.97 | |
| 2cf7_A | 165 | DPR; peroxide resistance, DPS-family, ferritin-lik | 98.96 | |
| 3ak8_A | 167 | DNA protection during starvation protein; DPS-like | 98.96 | |
| 2xgw_A | 199 | Peroxide resistance protein; metal binding protein | 98.94 | |
| 3iq1_A | 159 | DPS family protein; csgid, SAD, niaid, metal trans | 98.85 | |
| 3kwo_A | 152 | Putative bacterioferritin; alpha-helix, bacterial | 98.82 | |
| 4eve_A | 164 | Neutrophil-activating protein; dodecamer, four-hel | 98.8 | |
| 2pyb_A | 151 | NAPA, neutrophil activating protein; ferritin, DPS | 98.77 | |
| 2oh3_A | 167 | Rubrerythrin, COG1633: uncharacterized conserved p | 98.33 | |
| 2fzf_A | 175 | Hypothetical protein; structural genomics, southea | 98.18 | |
| 4etr_A | 153 | Putative uncharacterized protein; DUF2383, domain | 97.81 | |
| 4a25_A | 169 | DPS, ferritin DPS family protein; metal binding pr | 97.73 | |
| 3qhb_A | 179 | Symerythrin, ORF180; four-helix bundle, carboxylat | 97.7 | |
| 1vjx_A | 157 | Putative ferritin-like DIIRON-carboxylate protein; | 96.9 | |
| 3fse_A | 365 | Two-domain protein containing DJ-1/THIJ/PFPI-like | 96.63 | |
| 1zs3_A | 182 | Lactococcus lactis Mg1363 DPSA; oxidative stress, | 95.41 | |
| 1zuj_A | 179 | Hypothetical protein llacc01001955; oxidative stre | 95.36 | |
| 2ib0_A | 170 | Conserved hypothetical alanine rich protein; 4-hel | 95.3 | |
| 3k6c_A | 95 | Uncharacterized protein NE0167; structural genomic | 95.29 | |
| 1o9i_A | 266 | Pseudocatalase; oxidoreductase, hexamer, dimangane | 95.25 | |
| 1zpy_A | 95 | Hypothetical protein NE0167; structural genomics, | 95.17 | |
| 2v8t_A | 302 | Manganese-containing pseudocatalase; manganese cat | 94.87 | |
| 1vjx_A | 157 | Putative ferritin-like DIIRON-carboxylate protein; | 90.8 | |
| 3hl1_A | 317 | Ferritin like protein; structural genomics, joint | 90.69 | |
| 4di0_A | 144 | Rubrerythrin; ssgcid, seattle structural genomics | 90.51 | |
| 2qqy_A | 149 | Sigma B operon; dodecameric alpha-helical, ferriti | 89.14 | |
| 1j30_A | 144 | 144AA long hypothetical rubrerythrin; sulerythrin, | 88.95 | |
| 2fzf_A | 175 | Hypothetical protein; structural genomics, southea | 88.71 | |
| 2e0z_A | 345 | Virus-like particle; bacteriophage, HK97; 3.60A {P | 88.11 | |
| 2itb_A | 206 | TRNA-(MS(2)IO(6)A)-hydroxylase, putative; putative | 85.31 | |
| 3uoi_A | 161 | Bacterioferritin, BFR; structural genomics, TB str | 84.85 | |
| 3q4o_A | 196 | Uncharacterized protein MJ0754; ferritin-like prot | 83.8 | |
| 3qhb_A | 179 | Symerythrin, ORF180; four-helix bundle, carboxylat | 83.19 | |
| 4am5_A | 159 | Bacterioferritin; metal binding protein, ferroxida | 82.53 | |
| 3qb9_A | 174 | Bacterioferritin, BFR; cytosol, structural genomic | 82.24 | |
| 2y3q_A | 158 | Bacterioferritin; metal binding protein, redox; HE | 82.12 | |
| 1nfv_A | 179 | Bacterioferritin; 24 subunits in the active molecu | 81.99 | |
| 3r2k_A | 154 | Bacterioferritin, BFR; bacterial ferritin, iron bi | 80.52 |
| >3vnx_A Ferritin; 4-helix bundle, iron storage, oxidoreductase; 2.40A {Ulva pertusa} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.6e-50 Score=341.69 Aligned_cols=151 Identities=57% Similarity=0.892 Sum_probs=141.9
Q ss_pred CccccccccchHHhHhhhhcCCCCC-cchhhhccccHHHHHHHHhhhhhhhhHHHHHHHHHHhhccCccchhhHHHHHHH
Q 028161 58 MPLTGVVFQPFEEVKKEVLDVPVSP-LLSLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKE 136 (212)
Q Consensus 58 ~~~~~~~~~p~~e~~~~~~~~~~~~-~~s~~Rq~~s~e~e~aLNeQIn~EL~ASy~YLsmAa~Fdrd~vgL~GfAkfFr~ 136 (212)
+++|||||+||+|||+++.+||++| ..|++||||+++|+++||+|||.||+|||+|++||+||+++||||+||++||++
T Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~rq~~~~~v~~~LN~qin~EL~As~~Ylsma~~f~~~d~~l~g~a~~f~~ 81 (204)
T 3vnx_A 2 QEVTGMVFQPFSEVQGELSTVTQAPVTDSYARVEYHIECEAAINEQINIEYTISYVYHALHSYFARDNVGLPGFAKFFKE 81 (204)
T ss_dssp ------CCCHHHHTHHHHHHHHHCCTTSCSSCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTTCCHHHHHHHHH
T ss_pred CCCCcceeccHHHHHHHHhcCCCCCCccccceecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHH
Confidence 5799999999999999999999999 679999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHhcCCeeeeccccCCCCCCCccccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Q 028161 137 SSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVICLYH 208 (212)
Q Consensus 137 qS~EEreHAekLikY~n~RGG~V~l~~I~~P~~~f~~~e~~d~lealE~AL~lEK~vt~~L~~L~~lA~~~~ 208 (212)
+|+|||+||++||+||++|||+|++++|++|..+|++++|++++++|+.+|++||.+++.|++||++|.+.+
T Consensus 82 ~s~EE~~HA~kLi~yi~~rGG~~~l~~i~~p~~~~~~~~~~~~~e~le~aL~~Ek~v~~~l~~l~~lA~~~~ 153 (204)
T 3vnx_A 82 ASDEEREHAHMLMDYQTKRGGRVELKPLAAPEMEFANDDKGEALYAMELALSLEKLNFQKLQALQAIADKHK 153 (204)
T ss_dssp HHHHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCCCCCTTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred HHHHHHHHHHHHHHHHHHcCCCcccCCCCCCCccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Confidence 999999999999999999999999999999999999999999999999999999999999999999998754
|
| >3a68_A Sferh-4, ferritin-4, chloroplastic; 4-helix bundle, iron storage, CAGE-like protein, plant, iron, metal-binding, oxidoreductase, plastid; 1.80A {Glycine max} PDB: 3a9q_A | Back alignment and structure |
|---|
| >3kxu_A Ferritin; iron storage protein, disorder, iron, metal binding protein; 1.85A {Homo sapiens} PDB: 3hx2_A 3hx5_A 3hx7_A | Back alignment and structure |
|---|
| >3ka8_A Ferritin, middle subunit; iron storage, DIIRON, iron, metal-binding, oxidoreductase; 1.35A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 3ka9_A 3ka3_A 1mfr_A 3ka4_A 3rbc_A 3re7_A 3rgd_A 4das_A* 3ka6_A 3shx_A 3sh6_A 3se1_A 1bg7_A | Back alignment and structure |
|---|
| >2cih_A Ferritin heavy chain; apoferritin, ferroxidase, DI-iron non-heme protein, iron storage, iron, metal-binding, oxidoreductase, phosphorylation; 1.5A {Homo sapiens} PDB: 2chi_A 2cei_A 1fha_A 2fha_A 2cn7_A 2iu2_A 2clu_A 2cn6_A 3ajo_A 3ajq_A 3ajp_A 3erz_A 3es3_A 2z6m_A 1r03_A | Back alignment and structure |
|---|
| >1rcd_A L ferritin; iron storage; 2.00A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 1rcg_A 1rci_A 1rcc_A 1rce_A | Back alignment and structure |
|---|
| >1z6o_M Ferritin heavy chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >2v2p_A Ferritin light chain; metal transport, iron, haemin, apoferritin, iron storage, metal-binding; 1.15A {Equus caballus} PDB: 2v2r_A 2v2m_A 2v2l_A 2v2s_A 2v2o_A 2v2n_A 2za6_A 2v2j_A 2v2i_A 2z5p_A 1dat_A 2g4h_A 1aew_A 3h7g_A 2zg9_X 2zg8_X 3fi6_A 3o7r_A 2w0o_A 1hrs_A* ... | Back alignment and structure |
|---|
| >1z6o_A Ferritin light chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >3e6s_A Ferritin; iron storage, ferroxidase, oxidoreductase; 1.95A {Pseudo-nitzschia multiseries} SCOP: a.25.1.1 PDB: 3e6r_A | Back alignment and structure |
|---|
| >1s3q_A Ferritin; ferroxidase, four helix bundle, iron storage, metal binding; 2.10A {Archaeoglobus fulgidus} SCOP: a.25.1.1 PDB: 1sq3_A 3kx9_A | Back alignment and structure |
|---|
| >3uno_A Probable bacterioferritin BFRB; ferroxidase activity, iron storage, oxidoreductase; 2.50A {Mycobacterium tuberculosis} PDB: 3oj5_A 3qd8_A | Back alignment and structure |
|---|
| >3qz3_A Ferritin; structural genomics, the center for structural genomics of I diseases, csgid, cytoplasmic, oxidoreductase; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >1eum_A Ferritin 1; ECFTNA, metal binding protein; 2.05A {Escherichia coli} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >1krq_A Ferritin; H-chain like four-helix bundle, binding protein; 2.70A {Campylobacter jejuni} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >1vlg_A Ferritin; TM1128, structural genomics, JCSG, protein structu initiative, PSI, joint center for structural genomics, META protein; 2.00A {Thermotoga maritima} SCOP: a.25.1.1 PDB: 1z4a_A* | Back alignment and structure |
|---|
| >4am5_A Bacterioferritin; metal binding protein, ferroxidase centre, iron storage, DI centre, iron channel, heme binding; HET: HEM; 1.58A {Blastochloris viridis} PDB: 4am2_A* 4am4_A* | Back alignment and structure |
|---|
| >2jd6_0 Ferritin homolog, ferritin; metal transport, iron, pores, archaeon, entry channels, thermostability, hyperthermophIle, ferroxidase center; 2.75A {Pyrococcus furiosus} PDB: 2jd7_0 2jd8_0 2x17_0 | Back alignment and structure |
|---|
| >3oj5_A Ferritin family protein; ferroxidase, cytosol, oxidoreductase; 2.85A {Mycobacterium tuberculosis} PDB: 3qd8_A | Back alignment and structure |
|---|
| >3uoi_A Bacterioferritin, BFR; structural genomics, TB structural genomics consortium, TBSG ferroxidation and iron storage, cytosol; HET: HEM; 1.90A {Mycobacterium tuberculosis} PDB: 3uof_A* 3qb9_A* 2wtl_A* 3bkn_A* | Back alignment and structure |
|---|
| >3r2k_A Bacterioferritin, BFR; bacterial ferritin, iron binding, iron storage, iron homeost iron release, iron mobilization; 1.55A {Pseudomonas aeruginosa} SCOP: a.25.1.0 PDB: 3r2h_A 3r2l_A 3r2m_A 3r2o_A 3r2r_A 3r2s_A | Back alignment and structure |
|---|
| >3gvy_A Bacterioferritin; iron storage, DI-iron, ferroxida activity, heme, metal binding protein; HET: HEM; 2.80A {Rhodobacter sphaeroides} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >2y3q_A Bacterioferritin; metal binding protein, redox; HET: HEM; 1.55A {Escherichia coli} PDB: 1bfr_A* 1bcf_A* 2htn_A* 2vxi_A* 3e1j_A* 3e1l_A* 3e1m_A* 3e1n_A* 3e1o_A* 3e1p_A* 3ghq_A* 3e1q_A* 3e2c_A* 3isf_A* 3is8_A* 3ise_A* 3is7_A* | Back alignment and structure |
|---|
| >3fvb_A Bacterioferritin; niaid, ssgcid, decode, structural genomics, seattle structural genomics center for infectious disease; HET: HEM; 1.81A {Brucella melitensis biovar ABORTUS2308} | Back alignment and structure |
|---|
| >3qb9_A Bacterioferritin, BFR; cytosol, structural genomics, TB structural genomics consort TBSGC, metal binding protein; HET: HEM; 2.11A {Mycobacterium tuberculosis} PDB: 2wtl_A* 3bkn_A* | Back alignment and structure |
|---|
| >1nfv_A Bacterioferritin; 24 subunits in the active molecule, DIIRON HAEM Fe-coproporphyrin III cofactor, iron storage-electron complex; HET: FEC; 1.95A {Desulfovibrio desulfuricans} SCOP: a.25.1.1 PDB: 1nf6_A* 1nf4_A* | Back alignment and structure |
|---|
| >1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A | Back alignment and structure |
|---|
| >1jgc_A Bacterioferritin, BFR; iron storage protein, metal binding protein; HET: HEM; 2.60A {Rhodobacter capsulatus} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >2fkz_A Bacterioferritin; ferroxidase, DIIRON site, iron T metal binding protein; HET: HEM; 2.00A {Azotobacter vinelandii} SCOP: a.25.1.1 PDB: 2fl0_A* 1sof_A* | Back alignment and structure |
|---|
| >2vzb_A Putative bacterioferritin-related protein; DPS, DPSL, iron, oxidative stress, metal transport; 2.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1j30_A 144AA long hypothetical rubrerythrin; sulerythrin, sulfolobus tokodaii strain 7, FOU bundle, domain swapping, metal binding site plasticity; 1.70A {Sulfolobus tokodaii} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >2qqy_A Sigma B operon; dodecameric alpha-helical, ferritin fold, structural genomic protein structure initiative; 2.00A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2c41_A DPS family DNA-binding stress response protein; iron-binding/oxidation protein, DPS (DNA-binding proteins from starved cells); HET: PG4 PGE; 1.81A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >1ji5_A DLP-1; dodecamer, four-helix bundle, metal transport; 2.50A {Bacillus anthracis} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >1n1q_A DPS protein; four-helix bundle, unknown function; 2.20A {Brevibacillus brevis} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >2vxx_A Starvation induced DNA binding protein; stress response protein, DPS, oxidation, iron binding, ferroxidase centre; HET: PG4; 2.40A {Synechococcus elongatus} | Back alignment and structure |
|---|
| >1jig_A DLP-2; dodecamer, four-helix bundle, metal transport; 1.46A {Bacillus anthracis} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >2d5k_A DPS, DPS family protein; four helix bundle, metal binding protein; 1.85A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2clb_A DPS-like protein; DI-iron carboxylate, hypothetical protein, bacterioferritin, hydrogen peroxide, metal binding protein, archaea; 2.4A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A | Back alignment and structure |
|---|
| >1tjo_A Iron-rich DPSA-homolog protein; ferritin, low-iron, metal binding protein; 1.60A {Halobacterium salinarum} SCOP: a.25.1.1 PDB: 1moj_A 1tk6_A 1tko_A 1tkp_A | Back alignment and structure |
|---|
| >3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A | Back alignment and structure |
|---|
| >2fjc_A Antigen TPF1; mini ferritin, iron binding protein, metal transport; 2.50A {Treponema pallidum} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >1o9r_A Agrobacterium tumefaciens DPS; iron-binding protein, DNA protection from oxidative damage, DNA-binding, iron- binding protein; 1.45A {Agrobacterium tumefaciens} SCOP: a.25.1.1 PDB: 3ge4_A* | Back alignment and structure |
|---|
| >2chp_A MRGA, metalloregulation DNA-binding stress protein; DNA-binding protein, DPS, dodecameric, ferritin; 2.0A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4di0_A Rubrerythrin; ssgcid, seattle structural genomics center for infectious DI peroxidase, oxidoreductase; 1.90A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2bk6_A Non-heme iron-containing ferritin; DPS (DNA binding protein from starved cells), ferroxidase center, mutagenesis study; 2.19A {Listeria innocua} SCOP: a.25.1.1 PDB: 1qgh_A 2bjy_A 2iy4_A 2bkc_A | Back alignment and structure |
|---|
| >2yjk_A AFP, DPS; metal-binding protein, iron uptake, ferritin fold; 2.00A {Microbacterium arborescens} PDB: 2yjj_A | Back alignment and structure |
|---|
| >2c2u_A DPS, DNA-binding stress response protein; DNA-binding protein, iron; 1.1A {Deinococcus radiodurans} PDB: 2c2f_A 2f7n_A | Back alignment and structure |
|---|
| >2z90_A Starvation-inducible DNA-binding protein or FINE tangled PILI major subunit; quarternary assembly, ferroxidation; 2.40A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >2yw6_A DNA protection during starvation protein; DNA-binding protein, quarternary assembly, ferroxidation, oxidoreductase; HET: DNA; 2.53A {Mycobacterium smegmatis} SCOP: a.25.1.1 PDB: 1vei_A 1vel_A 1veq_A 1uvh_A* 2yw7_A | Back alignment and structure |
|---|
| >2wlu_A DPS-like peroxide resistance protein; DNA-binding, oxidoreductase; 1.94A {Streptococcus pyogenes} PDB: 2wla_A | Back alignment and structure |
|---|
| >2c2j_A DNA-binding stress response protein; DNA-binding protein, DPS; 2.05A {Deinococcus radiodurans} PDB: 2c6r_A | Back alignment and structure |
|---|
| >2cf7_A DPR; peroxide resistance, DPS-family, ferritin-like, ferroxidase, iron-binding; HET: EPE; 1.50A {Streptococcus suis} PDB: 2ux1_A* 2bw1_A* 1umn_A* 2v15_A* 2xjm_A* 2xjn_A* 2xjo_A* 2xkq_A* | Back alignment and structure |
|---|
| >3ak8_A DNA protection during starvation protein; DPS-like protein, dodecamer, iron-binding protein, metal BIN protein, oxidoreductase; HET: DNA; 1.25A {Salmonella enterica subsp} PDB: 3ak9_A* 1f33_A* 1f30_A* 1dps_A 1jts_A* 1jre_A* 1l8h_A* 1l8i_A* 4dyu_A* | Back alignment and structure |
|---|
| >2xgw_A Peroxide resistance protein; metal binding protein; 2.10A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3iq1_A DPS family protein; csgid, SAD, niaid, metal transport, STRU genomics, center for structural genomics of infectious DISE; 1.67A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3kwo_A Putative bacterioferritin; alpha-helix, bacterial ferritin fold, structural genomics, center for structural genomics of infectious diseases; 1.99A {Campylobacter jejuni} SCOP: a.25.1.0 | Back alignment and structure |
|---|
| >4eve_A Neutrophil-activating protein; dodecamer, four-helix bundle, metal transport; 2.10A {Helicobacter pylori} PDB: 4evd_A 3t9j_A 3ta8_A 4evb_A 4evc_A 1ji4_A | Back alignment and structure |
|---|
| >2pyb_A NAPA, neutrophil activating protein; ferritin, DPS, four-helix bundle, metal transport; 2.60A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >2oh3_A Rubrerythrin, COG1633: uncharacterized conserved protein; ZP_00055496.1, COG1633: uncharacterized conSer protein; HET: MSE PGE; 2.00A {Magnetospirillum magnetotacticum} SCOP: a.25.1.8 | Back alignment and structure |
|---|
| >2fzf_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.70A {Pyrococcus furiosus} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >4etr_A Putative uncharacterized protein; DUF2383, domain of unknown function, cytoplasmic, unknown FU; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4a25_A DPS, ferritin DPS family protein; metal binding protein, detoxification process; 2.00A {Kineococcus radiotolerans} | Back alignment and structure |
|---|
| >3qhb_A Symerythrin, ORF180; four-helix bundle, carboxylate bridged-DIIRON, ferritin-like superfamily, metal transport; 1.20A {Cyanophora paradoxa} PDB: 3qhc_A 3sid_A | Back alignment and structure |
|---|
| >1vjx_A Putative ferritin-like DIIRON-carboxylate protein; structural genomics, joint center for structural genomics, J protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1zs3_A Lactococcus lactis Mg1363 DPSA; oxidative stress, DNA binding, lactic acid bacteria, DNA binding protein; 2.70A {Lactococcus lactis} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >1zuj_A Hypothetical protein llacc01001955; oxidative stress, DPS, DNA binding, lactic acid bacteria, DN protein; 2.90A {Lactococcus lactis} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >2ib0_A Conserved hypothetical alanine rich protein; 4-helix bundle, structural genomics, PSI-2, protein structur initiative; 2.00A {Mycobacterium tuberculosis} SCOP: a.25.1.9 | Back alignment and structure |
|---|
| >3k6c_A Uncharacterized protein NE0167; structural genomics, MCSG, unknown function protein, PSI, PR structure initiative; 2.20A {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1o9i_A Pseudocatalase; oxidoreductase, hexamer, dimanganese catalase, metalloenzyme, preoxidase; HET: MES; 1.33A {Lactobacillus plantarum} SCOP: a.25.1.3 PDB: 1jkv_A 1jku_A | Back alignment and structure |
|---|
| >1zpy_A Hypothetical protein NE0167; structural genomics, MCSG, PSI, protein structure initiative; 2.20A {Nitrosomonas europaea atcc 19718} PDB: 3k6c_A | Back alignment and structure |
|---|
| >2v8t_A Manganese-containing pseudocatalase; manganese catalase, oxidoreductase; 0.98A {Thermus thermophilus} PDB: 2v8u_A 2cwl_A | Back alignment and structure |
|---|
| >1vjx_A Putative ferritin-like DIIRON-carboxylate protein; structural genomics, joint center for structural genomics, J protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >3hl1_A Ferritin like protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Caulobacter vibrioides} | Back alignment and structure |
|---|
| >4di0_A Rubrerythrin; ssgcid, seattle structural genomics center for infectious DI peroxidase, oxidoreductase; 1.90A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2qqy_A Sigma B operon; dodecameric alpha-helical, ferritin fold, structural genomic protein structure initiative; 2.00A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1j30_A 144AA long hypothetical rubrerythrin; sulerythrin, sulfolobus tokodaii strain 7, FOU bundle, domain swapping, metal binding site plasticity; 1.70A {Sulfolobus tokodaii} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >2fzf_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.70A {Pyrococcus furiosus} SCOP: a.25.1.1 | Back alignment and structure |
|---|
| >2e0z_A Virus-like particle; bacteriophage, HK97; 3.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2itb_A TRNA-(MS(2)IO(6)A)-hydroxylase, putative; putative ATTH, structural genomics, joint center for structu genomics, JCSG; 2.05A {Pseudomonas putida} SCOP: a.25.1.7 | Back alignment and structure |
|---|
| >3uoi_A Bacterioferritin, BFR; structural genomics, TB structural genomics consortium, TBSG ferroxidation and iron storage, cytosol; HET: HEM; 1.90A {Mycobacterium tuberculosis} PDB: 3uof_A* 3qb9_A* 2wtl_A* 3bkn_A* | Back alignment and structure |
|---|
| >3q4o_A Uncharacterized protein MJ0754; ferritin-like protein, four-helix bundle, metal binding, DIN center, unknown function; HET: B3P; 1.34A {Methanocaldococcus jannaschii} PDB: 3q4q_A* 3q4r_A* 3q4n_A | Back alignment and structure |
|---|
| >3qhb_A Symerythrin, ORF180; four-helix bundle, carboxylate bridged-DIIRON, ferritin-like superfamily, metal transport; 1.20A {Cyanophora paradoxa} PDB: 3qhc_A 3sid_A | Back alignment and structure |
|---|
| >4am5_A Bacterioferritin; metal binding protein, ferroxidase centre, iron storage, DI centre, iron channel, heme binding; HET: HEM; 1.58A {Blastochloris viridis} PDB: 4am2_A* 4am4_A* | Back alignment and structure |
|---|
| >3qb9_A Bacterioferritin, BFR; cytosol, structural genomics, TB structural genomics consort TBSGC, metal binding protein; HET: HEM; 2.11A {Mycobacterium tuberculosis} PDB: 2wtl_A* 3bkn_A* | Back alignment and structure |
|---|
| >2y3q_A Bacterioferritin; metal binding protein, redox; HET: HEM; 1.55A {Escherichia coli} PDB: 1bfr_A* 1bcf_A* 2htn_A* 2vxi_A* 3e1j_A* 3e1l_A* 3e1m_A* 3e1n_A* 3e1o_A* 3e1p_A* 3ghq_A* 3e1q_A* 3e2c_A* 3isf_A* 3is8_A* 3ise_A* 3is7_A* | Back alignment and structure |
|---|
| >1nfv_A Bacterioferritin; 24 subunits in the active molecule, DIIRON HAEM Fe-coproporphyrin III cofactor, iron storage-electron complex; HET: FEC; 1.95A {Desulfovibrio desulfuricans} SCOP: a.25.1.1 PDB: 1nf6_A* 1nf4_A* | Back alignment and structure |
|---|
| >3r2k_A Bacterioferritin, BFR; bacterial ferritin, iron binding, iron storage, iron homeost iron release, iron mobilization; 1.55A {Pseudomonas aeruginosa} SCOP: a.25.1.0 PDB: 3r2h_A 3r2l_A 3r2m_A 3r2o_A 3r2r_A 3r2s_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 212 | ||||
| d1z6oa1 | 200 | a.25.1.1 (A:13-212) (Apo)ferritin {Cabbage looper( | 5e-39 | |
| d1z6om1 | 191 | a.25.1.1 (M:1-191) (Apo)ferritin {Cabbage looper(T | 5e-38 | |
| d1rcda_ | 171 | a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesb | 1e-33 | |
| d1lb3a_ | 179 | a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) | 2e-33 | |
| d1bg7a_ | 173 | a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesb | 8e-33 | |
| d1r03a_ | 171 | a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), | 2e-31 | |
| d1vlga_ | 164 | a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritim | 5e-26 | |
| d1s3qa1 | 162 | a.25.1.1 (A:3-164) Non-hem ferritin {Archaeon Arch | 3e-25 | |
| d1euma_ | 161 | a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, | 4e-25 | |
| d1krqa_ | 165 | a.25.1.1 (A:) Non-hem ferritin {Campylobacter jeju | 6e-24 | |
| d2htna1 | 158 | a.25.1.1 (A:1-158) Bacterioferritin (cytochrome b1 | 3e-11 | |
| d1jgca_ | 160 | a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Rh | 5e-10 | |
| d1nf4a_ | 169 | a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {De | 6e-10 | |
| d2fkza1 | 154 | a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1 | 3e-07 |
| >d1z6oa1 a.25.1.1 (A:13-212) (Apo)ferritin {Cabbage looper(Trichoplusia ni), L chain [TaxId: 7111]} Length = 200 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Ferritin-like superfamily: Ferritin-like family: Ferritin domain: (Apo)ferritin species: Cabbage looper(Trichoplusia ni), L chain [TaxId: 7111]
Score = 131 bits (330), Expect = 5e-39
Identities = 23/118 (19%), Positives = 41/118 (34%), Gaps = 1/118 (0%)
Query: 87 ARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAE 146
+ + SY Y AYF+ G +K FK+ S+E
Sbjct: 17 GEYGSHGNVATELQAYAKLHLERSYDYLLSAAYFNNYQTNRAGFSKLFKKLSDEAWSKTI 76
Query: 147 KFMEYQNLRGGKVKLHSIMQPPSEF-DHAEKGDALYAMELALSLEKLTNEKLLSLHSV 203
+++ RG K+ +E ++ + L A+ AL +K E+ +H
Sbjct: 77 DIIKHVTKRGDKMNFDQHSTMKTERKNYTAENHELEALAKALDTQKELAERAFYIHRE 134
|
| >d1z6om1 a.25.1.1 (M:1-191) (Apo)ferritin {Cabbage looper(Trichoplusia ni), H chain [TaxId: 7111]} Length = 191 | Back information, alignment and structure |
|---|
| >d1rcda_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} Length = 171 | Back information, alignment and structure |
|---|
| >d1lb3a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 | Back information, alignment and structure |
|---|
| >d1bg7a_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} Length = 173 | Back information, alignment and structure |
|---|
| >d1r03a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), mitocondial isoform [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d1vlga_ a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]} Length = 164 | Back information, alignment and structure |
|---|
| >d1s3qa1 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 162 | Back information, alignment and structure |
|---|
| >d1euma_ a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, FtnA [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1krqa_ a.25.1.1 (A:) Non-hem ferritin {Campylobacter jejuni [TaxId: 197]} Length = 165 | Back information, alignment and structure |
|---|
| >d2htna1 a.25.1.1 (A:1-158) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} Length = 158 | Back information, alignment and structure |
|---|
| >d1jgca_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Rhodobacter capsulatus [TaxId: 1061]} Length = 160 | Back information, alignment and structure |
|---|
| >d1nf4a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]} Length = 169 | Back information, alignment and structure |
|---|
| >d2fkza1 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]} Length = 154 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 212 | |||
| d1rcda_ | 171 | (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: | 100.0 | |
| d1bg7a_ | 173 | (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: | 100.0 | |
| d1lb3a_ | 179 | (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090] | 100.0 | |
| d1r03a_ | 171 | (Apo)ferritin {Human (Homo sapiens), mitocondial i | 100.0 | |
| d1z6oa1 | 200 | (Apo)ferritin {Cabbage looper(Trichoplusia ni), L | 100.0 | |
| d1z6om1 | 191 | (Apo)ferritin {Cabbage looper(Trichoplusia ni), H | 100.0 | |
| d1vlga_ | 164 | Non-hem ferritin {Thermotoga maritima [TaxId: 2336 | 99.97 | |
| d1krqa_ | 165 | Non-hem ferritin {Campylobacter jejuni [TaxId: 197 | 99.97 | |
| d1s3qa1 | 162 | Non-hem ferritin {Archaeon Archaeoglobus fulgidus | 99.97 | |
| d1euma_ | 161 | Non-hem ferritin {Escherichia coli, FtnA [TaxId: 5 | 99.97 | |
| d2fkza1 | 154 | Bacterioferritin (cytochrome b1) {Azotobacter vine | 99.88 | |
| d1jgca_ | 160 | Bacterioferritin (cytochrome b1) {Rhodobacter caps | 99.87 | |
| d2htna1 | 158 | Bacterioferritin (cytochrome b1) {Escherichia coli | 99.86 | |
| d1nf4a_ | 169 | Bacterioferritin (cytochrome b1) {Desulfovibrio de | 99.84 | |
| d1yuza1 | 135 | Nigerythrin, N-terminal domain {Desulfovibrio vulg | 99.77 | |
| d1j30a_ | 141 | Hypothetical rubrerythrin {Archaeon Sulfolobus tok | 99.67 | |
| d1lkoa1 | 146 | Rubrerythrin, N-terminal domain {Desulfovibrio vul | 99.66 | |
| d1nnqa1 | 133 | Rubrerythrin, N-terminal domain {Archaeon Pyrococc | 99.11 | |
| d2oh3a1 | 152 | Uncharacterized protein AMB4284 homologue {Magneto | 98.8 | |
| d1o9ra_ | 162 | Dodecameric ferritin homolog {Agrobacterium tumefa | 98.68 | |
| d1umna_ | 151 | Dodecameric ferritin homolog {Streptococcus suis [ | 98.47 | |
| d1jiga_ | 146 | Dodecameric ferritin homolog {Bacillus anthracis, | 98.46 | |
| d1ji5a_ | 142 | Dodecameric ferritin homolog {Bacillus anthracis, | 98.41 | |
| d1tjoa_ | 180 | Dodecameric ferritin homolog {Archaeon Halobacteri | 98.41 | |
| d2fzfa1 | 158 | Hypothetical protein PF1190 {Archaeon Pyrococcus f | 98.41 | |
| d2ib0a1 | 142 | Hypothetical protein Rv2844 {Mycobacterium tubercu | 98.33 | |
| d2fjca1 | 151 | Dodecameric ferritin homolog {Treponema pallidum, | 98.28 | |
| d1n1qa_ | 149 | Dodecameric ferritin homolog {Bacillus brevis, Dps | 98.2 | |
| d1ji4a_ | 144 | Dodecameric ferritin homolog {Helicobacter pylori, | 98.12 | |
| d1vjxa_ | 149 | Hypothetical protein TM1526 {Thermotoga maritima [ | 97.87 | |
| d1dpsa_ | 159 | Dodecameric ferritin homolog {Escherichia coli, Dp | 97.79 | |
| d2bk6a1 | 150 | Dodecameric ferritin homolog {Listeria innocua [Ta | 97.79 | |
| d2yw6a1 | 141 | Dodecameric ferritin homolog {Mycobacterium smegma | 97.32 | |
| d1zs3a1 | 171 | Dodecameric ferritin homolog {Lactococcus lactis, | 96.21 | |
| d1zpya1 | 91 | Hypothetical protein NE0167 {Nitrosomonas europaea | 95.77 | |
| d1zuja1 | 168 | Dodecameric ferritin homolog {Lactococcus lactis, | 95.62 | |
| d2cwla1 | 299 | Manganese catalase (T-catalase) {Thermus thermophi | 91.25 | |
| d1yuza1 | 135 | Nigerythrin, N-terminal domain {Desulfovibrio vulg | 91.14 | |
| d1jkva_ | 266 | Manganese catalase (T-catalase) {Lactobacillus pla | 90.72 | |
| d1lkoa1 | 146 | Rubrerythrin, N-terminal domain {Desulfovibrio vul | 89.93 | |
| d1vjxa_ | 149 | Hypothetical protein TM1526 {Thermotoga maritima [ | 87.09 | |
| d2oh3a1 | 152 | Uncharacterized protein AMB4284 homologue {Magneto | 86.03 | |
| d2fkza1 | 154 | Bacterioferritin (cytochrome b1) {Azotobacter vine | 84.89 | |
| d2fzfa1 | 158 | Hypothetical protein PF1190 {Archaeon Pyrococcus f | 83.62 | |
| d2itba1 | 199 | Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 {Ps | 82.2 | |
| d1nf4a_ | 169 | Bacterioferritin (cytochrome b1) {Desulfovibrio de | 80.39 | |
| d1j30a_ | 141 | Hypothetical rubrerythrin {Archaeon Sulfolobus tok | 80.15 |
| >d1rcda_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Ferritin-like superfamily: Ferritin-like family: Ferritin domain: (Apo)ferritin species: Bullfrog (Rana catesbeiana) [TaxId: 8400]
Probab=100.00 E-value=1.6e-36 Score=247.75 Aligned_cols=120 Identities=46% Similarity=0.786 Sum_probs=114.5
Q ss_pred hhhhccccHHHHHHHHhhhhhhhhHHHHHHHHHHhhccCccchhhHHHHHHHHHHHHHHHHHHHHHHHHhcCCeeeeccc
Q 028161 85 SLARQKYEDECEAAINEQINVEYNVSYVYHALYAYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSI 164 (212)
Q Consensus 85 s~~Rq~~s~e~e~aLNeQIn~EL~ASy~YLsmAa~Fdrd~vgL~GfAkfFr~qS~EEreHAekLikY~n~RGG~V~l~~I 164 (212)
|++||||+++|+++||+|||.|++|||+|++||+||++++++||||++||+.+|+|||+||++|++||++|||.|++++|
T Consensus 1 ~~~r~n~~~e~~~aLN~qi~~El~as~~Yl~ma~~f~~~~~~l~g~a~~f~~~s~EE~~Ha~~l~~yi~~rgg~~~~~~i 80 (171)
T d1rcda_ 1 SQVRQNFHQDCEAGLNRTVNLKFHSSYVYLSMASYFNRDDVALSNFAKFFRERSEEEKEHAEKLIEYQNQRGGRVFLQSV 80 (171)
T ss_dssp CTTCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCCCCC
T ss_pred CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCceeccc
Confidence 68999999999999999999999999999999999999899999999999999999999999999999999999999999
Q ss_pred cCCCCCCCccccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Q 028161 165 MQPPSEFDHAEKGDALYAMELALSLEKLTNEKLLSLHSVICLYH 208 (212)
Q Consensus 165 ~~P~~~f~~~e~~d~lealE~AL~lEK~vt~~L~~L~~lA~~~~ 208 (212)
++|+. .+|.+++++|+.+|++||.+++.|++++++|.+.+
T Consensus 81 ~~~~~----~~~~s~~e~~~~al~~Ek~v~~~l~~l~~~a~~~~ 120 (171)
T d1rcda_ 81 EKPER----DDWANGLEALQTALKLQKSVNQALLDLHAVAADKS 120 (171)
T ss_dssp CCCSC----SCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred CCCCC----ccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHcC
Confidence 98875 35678999999999999999999999999998764
|
| >d1bg7a_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} | Back information, alignment and structure |
|---|
| >d1lb3a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r03a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), mitocondial isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z6oa1 a.25.1.1 (A:13-212) (Apo)ferritin {Cabbage looper(Trichoplusia ni), L chain [TaxId: 7111]} | Back information, alignment and structure |
|---|
| >d1z6om1 a.25.1.1 (M:1-191) (Apo)ferritin {Cabbage looper(Trichoplusia ni), H chain [TaxId: 7111]} | Back information, alignment and structure |
|---|
| >d1vlga_ a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1krqa_ a.25.1.1 (A:) Non-hem ferritin {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1s3qa1 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1euma_ a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, FtnA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fkza1 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1jgca_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2htna1 a.25.1.1 (A:1-158) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nf4a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1yuza1 a.25.1.1 (A:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1j30a_ a.25.1.1 (A:) Hypothetical rubrerythrin {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1lkoa1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1nnqa1 a.25.1.1 (A:2-134) Rubrerythrin, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]} | Back information, alignment and structure |
|---|
| >d1o9ra_ a.25.1.1 (A:) Dodecameric ferritin homolog {Agrobacterium tumefaciens, Dps [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1umna_ a.25.1.1 (A:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1jiga_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-2 [TaxId: 1392]} | Back information, alignment and structure |
|---|
| >d1ji5a_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-1 [TaxId: 1392]} | Back information, alignment and structure |
|---|
| >d1tjoa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum [TaxId: 2242]} | Back information, alignment and structure |
|---|
| >d2fzfa1 a.25.1.1 (A:10-167) Hypothetical protein PF1190 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2ib0a1 a.25.1.9 (A:17-158) Hypothetical protein Rv2844 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fjca1 a.25.1.1 (A:27-177) Dodecameric ferritin homolog {Treponema pallidum, TpF1 [TaxId: 160]} | Back information, alignment and structure |
|---|
| >d1n1qa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus brevis, Dps [TaxId: 1393]} | Back information, alignment and structure |
|---|
| >d1ji4a_ a.25.1.1 (A:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1vjxa_ a.25.1.1 (A:) Hypothetical protein TM1526 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dpsa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bk6a1 a.25.1.1 (A:7-156) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]} | Back information, alignment and structure |
|---|
| >d2yw6a1 a.25.1.1 (A:17-157) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]} | Back information, alignment and structure |
|---|
| >d1zs3a1 a.25.1.1 (A:3-173) Dodecameric ferritin homolog {Lactococcus lactis, DpsB [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1zpya1 a.25.1.5 (A:4-94) Hypothetical protein NE0167 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1zuja1 a.25.1.1 (A:6-173) Dodecameric ferritin homolog {Lactococcus lactis, DpsA [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2cwla1 a.25.1.3 (A:1-299) Manganese catalase (T-catalase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yuza1 a.25.1.1 (A:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1jkva_ a.25.1.3 (A:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1lkoa1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1vjxa_ a.25.1.1 (A:) Hypothetical protein TM1526 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]} | Back information, alignment and structure |
|---|
| >d2fkza1 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2fzfa1 a.25.1.1 (A:10-167) Hypothetical protein PF1190 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2itba1 a.25.1.7 (A:3-201) Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1nf4a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1j30a_ a.25.1.1 (A:) Hypothetical rubrerythrin {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|