Citrus Sinensis ID: 028177

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MAAIEWSWSRLMEFMIQSAHQLEVSPIVKYSALSLFADRFFPSLTRYTVGSNGKGNWLLQPIRESNLQLFALIALWISSKIHDSRPVSVKSFKSLGDKIIKDEHFTTRDFLEAEIVFMQVLDFEIGTSNIAFLLLEELLLQFKGVAKVGELLRFEACMDIMDLLYEKEETSTLYRSPRSLAASTLIASYLITVPKQRWEFPILPWGKYFFPL
cccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccEEECccccHHHHHHHHHHHHHccccccccccccccccccccc
***IEWSWSRLMEFMIQSAHQLEVSPIVKYSALSLFADRFFPSLTRYTVGSNGKGNWLLQPIRESNLQLFALIALWISSKIHDSRPVSVKSFKSLGDKIIKDEHFTTRDFLEAEIVFMQVLDFEIGTSNIAFLLLEELLLQFKGVAKVGELLRFEACMDIMDLLYEKEETSTLYRSPRSLAASTLIASYLITVPKQRWEFPILPWGKYFFPL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAIEWSWSRLMEFMIQSAHQLEVSPIVKYSALSLFADRFFPSLTRYTVGSNGKGNWLLQPIRESNLQLFALIALWISSKIHDSRPVSVKSFKSLGDKIIKDEHFTTRDFLEAEIVFMQVLDFEIGTSNIAFLLLEELLLQFKGVAKVGELLRFEACMDIMDLLYEKEETSTLYRSPRSLAASTLIASYLITVPKQRWEFPILPWGKYFFPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclin-J18 probableQ9C5X2
Cyclin-J18-like probableQ0DTM7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CCH, chain B
Confidence level:very confident
Coverage over the Query: 6-44,61-192
View the alignment between query and template
View the model in PyMOL
Template: 2I53, chain A
Confidence level:confident
Coverage over the Query: 7-46,61-207
View the alignment between query and template
View the model in PyMOL