Citrus Sinensis ID: 028192
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 212 | ||||||
| 255587806 | 211 | Calcium-binding allergen Ole e, putative | 0.929 | 0.933 | 0.600 | 2e-57 | |
| 224139756 | 216 | predicted protein [Populus trichocarpa] | 0.966 | 0.949 | 0.600 | 5e-55 | |
| 224090019 | 213 | predicted protein [Populus trichocarpa] | 0.971 | 0.967 | 0.575 | 2e-53 | |
| 357509533 | 216 | hypothetical protein MTR_7g090450 [Medic | 0.952 | 0.935 | 0.553 | 1e-51 | |
| 388508562 | 216 | unknown [Medicago truncatula] | 0.952 | 0.935 | 0.548 | 4e-51 | |
| 225441325 | 222 | PREDICTED: probable calcium-binding prot | 0.962 | 0.918 | 0.552 | 6e-51 | |
| 356571963 | 218 | PREDICTED: probable calcium-binding prot | 0.943 | 0.917 | 0.565 | 4e-48 | |
| 356504734 | 219 | PREDICTED: probable calcium-binding prot | 0.957 | 0.926 | 0.535 | 1e-45 | |
| 15228219 | 209 | putative calcium-binding protein CML36 [ | 0.933 | 0.947 | 0.515 | 1e-40 | |
| 297829546 | 206 | hypothetical protein ARALYDRAFT_897194 [ | 0.933 | 0.961 | 0.495 | 7e-40 |
| >gi|255587806|ref|XP_002534401.1| Calcium-binding allergen Ole e, putative [Ricinus communis] gi|223525358|gb|EEF27979.1| Calcium-binding allergen Ole e, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 227 bits (579), Expect = 2e-57, Method: Compositional matrix adjust.
Identities = 134/223 (60%), Positives = 161/223 (72%), Gaps = 26/223 (11%)
Query: 2 KLIEKLSPKRLFRSKSKKDRTSVSRSDP---SSFSSSSTSDSSTHNKLGSAPDRVGTPTS 58
+LI+ +SPKRLFRSK + RSDP SS SSS +S S H K + D +GTP S
Sbjct: 3 QLIKAISPKRLFRSKKGRS----IRSDPLSYSSSSSSDSSSSGFHQK--RSADNLGTPPS 56
Query: 59 VLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEE 118
VL ++SGDWSD+S+D ELVQA KL+D DNDG+V R++LE+LLIRLGA +EE
Sbjct: 57 VLPDLSGDWSDVSSDFF----SELVQAFKLMDNDNDGIVSRTQLESLLIRLGA----EEE 108
Query: 119 VKSMLSEVDREGDG---------RVGNSSCEPACEPELKETFDFFDADHDGKITAEELFG 169
V +MLSEVDR+GDG R+G +CEPA + EL+ F+FFD DHDGKITAEEL G
Sbjct: 109 VATMLSEVDRDGDGCISVEALMSRIGGPACEPAGDDELRVAFEFFDTDHDGKITAEELMG 168
Query: 170 VFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMMELQR 212
V+ +GDE CTLDDCR MIA VDKNGDGFVCFEDF+RMMELQR
Sbjct: 169 VYKAIGDERCTLDDCRRMIAGVDKNGDGFVCFEDFARMMELQR 211
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224139756|ref|XP_002323262.1| predicted protein [Populus trichocarpa] gi|222867892|gb|EEF05023.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224090019|ref|XP_002308908.1| predicted protein [Populus trichocarpa] gi|118488683|gb|ABK96152.1| unknown [Populus trichocarpa] gi|222854884|gb|EEE92431.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357509533|ref|XP_003625055.1| hypothetical protein MTR_7g090450 [Medicago truncatula] gi|355500070|gb|AES81273.1| hypothetical protein MTR_7g090450 [Medicago truncatula] gi|388494876|gb|AFK35504.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388508562|gb|AFK42347.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225441325|ref|XP_002276334.1| PREDICTED: probable calcium-binding protein CML35 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356571963|ref|XP_003554140.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356504734|ref|XP_003521150.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15228219|ref|NP_187630.1| putative calcium-binding protein CML36 [Arabidopsis thaliana] gi|75337581|sp|Q9SS31.1|CML36_ARATH RecName: Full=Probable calcium-binding protein CML36; AltName: Full=Calmodulin-like protein 36 gi|6056210|gb|AAF02827.1|AC009400_23 calmodulin-like protein [Arabidopsis thaliana] gi|27808532|gb|AAO24546.1| At3g10190 [Arabidopsis thaliana] gi|110736233|dbj|BAF00087.1| calmodulin like protein [Arabidopsis thaliana] gi|332641348|gb|AEE74869.1| putative calcium-binding protein CML36 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297829546|ref|XP_002882655.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. lyrata] gi|297328495|gb|EFH58914.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 212 | ||||||
| TAIR|locus:2076279 | 209 | AT3G10190 [Arabidopsis thalian | 0.943 | 0.956 | 0.475 | 5.9e-41 | |
| TAIR|locus:2040342 | 216 | AT2G41410 [Arabidopsis thalian | 0.910 | 0.893 | 0.472 | 5.5e-38 | |
| TAIR|locus:2024046 | 186 | AT1G24620 [Arabidopsis thalian | 0.603 | 0.688 | 0.381 | 4.6e-18 | |
| TAIR|locus:2201542 | 157 | CML23 "calmodulin like 23" [Ar | 0.646 | 0.872 | 0.339 | 1.6e-17 | |
| UNIPROTKB|F1P596 | 155 | Gga.31374 "Uncharacterized pro | 0.669 | 0.916 | 0.359 | 3.2e-17 | |
| TAIR|locus:2049460 | 144 | AT2G36180 [Arabidopsis thalian | 0.556 | 0.819 | 0.393 | 1.8e-16 | |
| TAIR|locus:2059324 | 181 | CAM5 "calmodulin 5" [Arabidops | 0.665 | 0.779 | 0.342 | 2.9e-16 | |
| TAIR|locus:2079641 | 153 | AGD11 "ARF-GAP domain 11" [Ara | 0.603 | 0.836 | 0.374 | 4.7e-16 | |
| TAIR|locus:2084543 | 173 | CML11 "calmodulin-like 11" [Ar | 0.632 | 0.774 | 0.351 | 6e-16 | |
| FB|FBgn0033238 | 163 | CG11165 [Drosophila melanogast | 0.646 | 0.840 | 0.351 | 6e-16 |
| TAIR|locus:2076279 AT3G10190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 435 (158.2 bits), Expect = 5.9e-41, P = 5.9e-41
Identities = 105/221 (47%), Positives = 131/221 (59%)
Query: 1 MKLIEKLSPKRLF-RSKSKKXXXXXXXXXXXXXXXXXXXXXXXHNKLGSAPDRVGTPTSV 59
MKL KL PKR F RSK + N G TPTS+
Sbjct: 1 MKLA-KLIPKRFFIRSKDRSTVSKSPTAFSFGSASSSSGQDCK-NSGGDGGGGSVTPTSI 58
Query: 60 LHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEV 119
L E+ +S + E++QA KL+DRDNDG V R +LE+LL RLG DP T+EE+
Sbjct: 59 LPEVPSPYSYV----------EILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEEEI 108
Query: 120 KSMLSEVDREGDGRVGNS-------SCEPACEP-ELKETFDFFDADHDGKITAEELFGVF 171
ML EVD +GDG + S +PA + ELKETF+FFDAD DG I+A+EL VF
Sbjct: 109 NVMLKEVDCDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRDGLISADELLRVF 168
Query: 172 TKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMMELQR 212
+ +GDE CTLDDC+ MIA VD++GDGFVCF +FSRMM+LQR
Sbjct: 169 STIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMMDLQR 209
|
|
| TAIR|locus:2040342 AT2G41410 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024046 AT1G24620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201542 CML23 "calmodulin like 23" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P596 Gga.31374 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2049460 AT2G36180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059324 CAM5 "calmodulin 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2079641 AGD11 "ARF-GAP domain 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2084543 CML11 "calmodulin-like 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033238 CG11165 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_LG_XVI0309 | hypothetical protein (217 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.29.316.1 | • | 0.800 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 212 | |||
| PTZ00184 | 149 | PTZ00184, PTZ00184, calmodulin; Provisional | 7e-19 | |
| COG5126 | 160 | COG5126, FRQ1, Ca2+-binding protein (EF-Hand super | 6e-18 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 9e-15 | |
| PTZ00183 | 158 | PTZ00183, PTZ00183, centrin; Provisional | 7e-13 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 2e-07 | |
| PTZ00184 | 149 | PTZ00184, PTZ00184, calmodulin; Provisional | 1e-06 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 6e-06 | |
| pfam13405 | 30 | pfam13405, EF_hand_4, EF-hand domain | 5e-05 | |
| pfam13833 | 53 | pfam13833, EF_hand_6, EF-hand domain pair | 6e-05 | |
| pfam00036 | 29 | pfam00036, efhand, EF hand | 2e-04 | |
| smart00054 | 29 | smart00054, EFh, EF-hand, calcium binding motif | 3e-04 | |
| pfam13202 | 25 | pfam13202, EF_hand_3, EF hand | 4e-04 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 8e-04 | |
| pfam00036 | 29 | pfam00036, efhand, EF hand | 0.004 | |
| smart00054 | 29 | smart00054, EFh, EF-hand, calcium binding motif | 0.004 |
| >gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional | Back alignment and domain information |
|---|
Score = 79.0 bits (195), Expect = 7e-19
Identities = 49/137 (35%), Positives = 76/137 (55%), Gaps = 11/137 (8%)
Query: 81 ELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEVKSMLSEVDREGDGRV------ 134
E +A L D+D DG + EL ++ LG +P T+ E++ M++EVD +G+G +
Sbjct: 12 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP-TEAELQDMINEVDADGNGTIDFPEFL 70
Query: 135 ---GNSSCEPACEPELKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALV 191
+ E E+KE F FD D +G I+A EL V T LG++L T ++ MI
Sbjct: 71 TLMARKMKDTDSEEEIKEAFKVFDRDGNGFISAAELRHVMTNLGEKL-TDEEVDEMIREA 129
Query: 192 DKNGDGFVCFEDFSRMM 208
D +GDG + +E+F +MM
Sbjct: 130 DVDGDGQINYEEFVKMM 146
|
Length = 149 |
| >gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain | Back alignment and domain information |
|---|
| >gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|200946 pfam00036, efhand, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|205383 pfam13202, EF_hand_3, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|200946 pfam00036, efhand, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 212 | |||
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.96 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.94 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 99.9 | |
| PTZ00183 | 158 | centrin; Provisional | 99.89 | |
| PTZ00184 | 149 | calmodulin; Provisional | 99.88 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 99.87 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 99.87 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 99.86 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 99.8 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 99.75 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 99.65 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 99.45 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 99.45 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 99.39 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 99.39 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 99.37 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 99.36 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 99.27 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 99.25 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 99.23 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 99.21 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 99.2 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 99.2 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.16 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 99.16 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 99.15 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 99.12 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 99.11 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 99.1 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 99.09 | |
| PTZ00183 | 158 | centrin; Provisional | 99.08 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 99.05 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 99.05 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 99.04 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.04 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 99.01 | |
| PTZ00184 | 149 | calmodulin; Provisional | 99.0 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 99.0 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 98.98 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 98.94 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 98.93 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 98.92 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 98.9 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 98.87 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 98.79 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 98.79 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 98.78 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 98.75 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 98.73 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 98.71 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 98.7 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 98.65 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 98.63 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.63 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 98.56 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 98.55 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 98.52 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 98.52 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 98.5 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 98.48 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 98.47 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 98.45 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 98.42 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 98.41 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 98.4 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 98.39 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 98.36 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 98.33 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 98.3 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 98.24 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 98.24 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 98.22 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 98.22 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 98.19 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 98.17 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 98.13 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 98.08 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 98.07 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 98.01 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 97.96 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 97.93 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 97.9 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 97.89 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 97.86 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 97.81 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 97.81 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 97.79 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.64 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 97.62 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 97.61 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 97.6 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 97.6 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 97.6 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 97.59 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 97.48 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 97.43 | |
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 97.37 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 97.1 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 97.0 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 96.89 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 96.83 | |
| KOG3555 | 434 | consensus Ca2+-binding proteoglycan Testican [Gene | 96.58 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 96.43 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 96.34 | |
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 96.14 | |
| KOG0035 | 890 | consensus Ca2+-binding actin-bundling protein (act | 95.68 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 95.4 | |
| PF05517 | 154 | p25-alpha: p25-alpha ; InterPro: IPR008907 This fa | 95.24 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 95.19 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 94.99 | |
| KOG4578 | 421 | consensus Uncharacterized conserved protein, conta | 94.93 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 94.79 | |
| PF08726 | 69 | EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr | 94.72 | |
| KOG2243 | 5019 | consensus Ca2+ release channel (ryanodine receptor | 94.61 | |
| KOG3866 | 442 | consensus DNA-binding protein of the nucleobindin | 94.6 | |
| PF09069 | 90 | EF-hand_3: EF-hand; InterPro: IPR015154 Like other | 94.38 | |
| KOG1265 | 1189 | consensus Phospholipase C [Lipid transport and met | 94.12 | |
| KOG0998 | 847 | consensus Synaptic vesicle protein EHS-1 and relat | 93.89 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 92.99 | |
| KOG0035 | 890 | consensus Ca2+-binding actin-bundling protein (act | 92.92 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 92.33 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 92.21 | |
| PLN02228 | 567 | Phosphoinositide phospholipase C | 91.59 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 90.93 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 90.49 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 89.56 | |
| KOG3555 | 434 | consensus Ca2+-binding proteoglycan Testican [Gene | 88.8 | |
| KOG0998 | 847 | consensus Synaptic vesicle protein EHS-1 and relat | 86.69 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 86.61 | |
| KOG4578 | 421 | consensus Uncharacterized conserved protein, conta | 83.98 |
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
Probab=99.96 E-value=7.1e-28 Score=176.45 Aligned_cols=138 Identities=32% Similarity=0.571 Sum_probs=129.7
Q ss_pred cccCCHHHHHHHHHHHHHhcCCCCCcccHHHHHHHHHHhCCCCCCHHHHHHHHHhhcCCCCcccccCCC---------CC
Q 028192 71 SADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEVKSMLSEVDREGDGRVGNSSC---------EP 141 (212)
Q Consensus 71 ~~~~t~~~~~~l~~~F~~~D~d~~G~I~~~el~~~l~~l~~~~~s~~~~~~l~~~~d~~~~g~i~~~e~---------~~ 141 (212)
..+|+.+++++|+++|..+|.|++|.|+..||..+|+.+|.. ++..++..|+..+|. +.+.|+|.+| ..
T Consensus 11 ~~~~t~~qi~~lkeaF~l~D~d~~G~I~~~el~~ilr~lg~~-~s~~ei~~l~~~~d~-~~~~idf~~Fl~~ms~~~~~~ 88 (160)
T COG5126 11 FTQLTEEQIQELKEAFQLFDRDSDGLIDRNELGKILRSLGFN-PSEAEINKLFEEIDA-GNETVDFPEFLTVMSVKLKRG 88 (160)
T ss_pred cccCCHHHHHHHHHHHHHhCcCCCCCCcHHHHHHHHHHcCCC-CcHHHHHHHHHhccC-CCCccCHHHHHHHHHHHhccC
Confidence 446888999999999999999999999999999999999998 999999999999999 8899999976 45
Q ss_pred CChhHHHHHHHhhcCCCCCccCHHHHHHHHHHhCCCCCCHHHHHHHHHHhcCCCCcceeHHHHHHHHHhC
Q 028192 142 ACEPELKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMMELQ 211 (212)
Q Consensus 142 ~~~~~l~~~F~~~D~d~~G~I~~~El~~~l~~~g~~~ls~~~~~~l~~~~d~~~dg~I~~~eF~~~l~~~ 211 (212)
...+++.++|+.||.|++|+|+..||+.+|..+|. .++++++++||+.+|.|++|.|+|++|++.+...
T Consensus 89 ~~~Eel~~aF~~fD~d~dG~Is~~eL~~vl~~lge-~~~deev~~ll~~~d~d~dG~i~~~eF~~~~~~~ 157 (160)
T COG5126 89 DKEEELREAFKLFDKDHDGYISIGELRRVLKSLGE-RLSDEEVEKLLKEYDEDGDGEIDYEEFKKLIKDS 157 (160)
T ss_pred CcHHHHHHHHHHhCCCCCceecHHHHHHHHHhhcc-cCCHHHHHHHHHhcCCCCCceEeHHHHHHHHhcc
Confidence 66899999999999999999999999999999995 8999999999999999999999999999988754
|
|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
| >KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes | Back alignment and domain information |
|---|
| >KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] | Back alignment and domain information |
|---|
| >PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions | Back alignment and domain information |
|---|
| >KOG1265 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 212 | ||||
| 3u0k_A | 440 | Crystal Structure Of The Genetically Encoded Calciu | 7e-16 | ||
| 1clm_A | 148 | Structure Of Paramecium Tetraurelia Calmodulin At 1 | 1e-15 | ||
| 1exr_A | 148 | The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca | 1e-15 | ||
| 2l1w_A | 149 | The Solution Structure Of Soybean Calmodulin Isofor | 2e-15 | ||
| 3sg7_A | 448 | Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 | 3e-15 | ||
| 2k0j_A | 148 | Solution Structure Of Cam Complexed To Drp1p Length | 4e-15 | ||
| 3sg5_A | 448 | Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke | 4e-15 | ||
| 3sg4_A | 448 | Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len | 5e-15 | ||
| 3sg3_A | 449 | Crystal Structure Of Gcamp3-D380y Length = 449 | 5e-15 | ||
| 3ek8_A | 449 | Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L | 7e-15 | ||
| 3evu_A | 449 | Crystal Structure Of Calcium Bound Dimeric Gcamp2, | 7e-15 | ||
| 3sg6_A | 450 | Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L | 8e-15 | ||
| 3evr_A | 411 | Crystal Structure Of Calcium Bound Monomeric Gcamp2 | 8e-15 | ||
| 1xfu_O | 149 | Crystal Structure Of Anthrax Edema Factor (ef) Trun | 8e-15 | ||
| 1ggz_A | 148 | Crystal Structure Of The Calmodulin-Like Protein (H | 9e-15 | ||
| 3o77_A | 415 | The Structure Of Ca2+ Sensor (Case-16) Length = 415 | 9e-15 | ||
| 3o78_A | 415 | The Structure Of Ca2+ Sensor (Case-12) Length = 415 | 9e-15 | ||
| 2f2o_A | 179 | Structure Of Calmodulin Bound To A Calcineurin Pept | 1e-14 | ||
| 4djc_A | 152 | 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA | 1e-14 | ||
| 1y0v_H | 146 | Crystal Structure Of Anthrax Edema Factor (Ef) In C | 1e-14 | ||
| 2wel_D | 150 | Crystal Structure Of Su6656-Bound CalciumCALMODULIN | 1e-14 | ||
| 3ewt_A | 154 | Crystal Structure Of Calmodulin Complexed With A Pe | 1e-14 | ||
| 1cm1_A | 148 | Motions Of Calmodulin-Single-Conformer Refinement L | 1e-14 | ||
| 2ygg_B | 150 | Complex Of Cambr And Cam Length = 150 | 1e-14 | ||
| 3ekh_A | 449 | Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER | 1e-14 | ||
| 1k93_D | 144 | Crystal Structure Of The Adenylyl Cyclase Domain Of | 1e-14 | ||
| 2be6_A | 150 | 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC | 1e-14 | ||
| 1iq5_A | 149 | CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE | 1e-14 | ||
| 2vay_A | 146 | Calmodulin Complexed With Cav1.1 Iq Peptide Length | 1e-14 | ||
| 4gow_D | 144 | Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX | 1e-14 | ||
| 1cdl_A | 147 | Target Enzyme Recognition By Calmodulin: 2.4 Angstr | 1e-14 | ||
| 2ix7_A | 145 | Structure Of Apo-Calmodulin Bound To Unconventional | 1e-14 | ||
| 1cdm_A | 144 | Modulation Of Calmodulin Plasticity In Molecular Re | 1e-14 | ||
| 3sg2_A | 449 | Crystal Structure Of Gcamp2-T116v,D381y Length = 44 | 1e-14 | ||
| 4aqr_A | 149 | Crystal Structure Of A Calmodulin In Complex With T | 1e-14 | ||
| 1prw_A | 149 | Crystal Structure Of Bovine Brain Ca++ Calmodulin I | 2e-14 | ||
| 1up5_B | 148 | Chicken Calmodulin Length = 148 | 2e-14 | ||
| 1qtx_A | 148 | The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept | 2e-14 | ||
| 1qs7_A | 145 | The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti | 3e-14 | ||
| 1rfj_A | 149 | Crystal Structure Of Potato Calmodulin Pcm6 Length | 3e-14 | ||
| 1dmo_A | 148 | Calmodulin, Nmr, 30 Structures Length = 148 | 3e-14 | ||
| 2bkh_B | 149 | Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc | 4e-14 | ||
| 2lv6_A | 148 | The Complex Between Ca-calmodulin And Skeletal Musc | 4e-14 | ||
| 2bbm_A | 148 | Solution Structure Of A Calmodulin-Target Peptide C | 4e-14 | ||
| 1ooj_A | 149 | Structural Genomics Of Caenorhabditis Elegans : Cal | 4e-14 | ||
| 2vb6_B | 149 | Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo | 7e-14 | ||
| 1vrk_A | 148 | The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 | 7e-14 | ||
| 1ahr_A | 146 | Calmodulin Mutant With A Two Residue Deletion In Th | 1e-13 | ||
| 1deg_A | 142 | The Linker Of Des-Glu84 Calmodulin Is Bent As Seen | 2e-13 | ||
| 2obh_A | 143 | Centrin-Xpc Peptide Length = 143 | 9e-12 | ||
| 3ekj_A | 449 | Calcium-Free Gcamp2 (Calcium Binding Deficient Muta | 2e-11 | ||
| 1xfx_O | 149 | Crystal Structure Of Anthrax Edema Factor (Ef) In C | 2e-11 | ||
| 1niw_A | 148 | Crystal Structure Of Endothelial Nitric Oxide Synth | 3e-11 | ||
| 1y6w_A | 148 | Trapped Intermediate Of Calmodulin Length = 148 | 5e-11 | ||
| 1tcf_A | 159 | Crystal Structure Of Calcium-Saturated Rabbit Skele | 9e-11 | ||
| 1a2x_A | 159 | Complex Of Troponin C With A 47 Residue (1-47) Frag | 2e-10 | ||
| 3qrx_A | 169 | Chlamydomonas Reinhardtii Centrin Bound To Melittin | 3e-10 | ||
| 3kf9_A | 149 | Crystal Structure Of The SdcenSKMLCK COMPLEX Length | 1e-09 | ||
| 5tnc_A | 162 | Refined Crystal Structure Of Troponin C From Turkey | 1e-09 | ||
| 4tnc_A | 162 | Refined Structure Of Chicken Skeletal Muscle Tropon | 2e-09 | ||
| 1ytz_C | 162 | Crystal Structure Of Skeletal Muscle Troponin In Th | 3e-09 | ||
| 2w49_0 | 159 | Isometrically Contracting Insect Asynchronous Fligh | 3e-09 | ||
| 2lhi_A | 176 | Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam L | 5e-09 | ||
| 1lkj_A | 146 | Nmr Structure Of Apo Calmodulin From Yeast Saccharo | 5e-09 | ||
| 4ds7_A | 147 | Crystal Structure Of Yeast Calmodulin Bound To The | 6e-09 | ||
| 2lhh_A | 128 | Solution Structure Of Ca2+-Bound Ycam Length = 128 | 1e-08 | ||
| 1tnw_A | 162 | Nmr Solution Structure Of Calcium Saturated Skeleta | 1e-08 | ||
| 3q5i_A | 504 | Crystal Structure Of Pbanka_031420 Length = 504 | 2e-08 | ||
| 2lmt_A | 148 | Nmr Structure Of Androcam Length = 148 | 2e-08 | ||
| 2kn2_A | 92 | Solution Structure Of The C-Terminal Domain Of Soyb | 6e-08 | ||
| 2rob_A | 70 | Solution Structure Of Calcium Bound Soybean Calmodu | 7e-08 | ||
| 2kxw_A | 73 | Structure Of The C-Domain Fragment Of Apo Calmoduli | 1e-07 | ||
| 3fwb_A | 161 | Sac3:sus1:cdc31 Complex Length = 161 | 1e-07 | ||
| 3igo_A | 486 | Crystal Structure Of Cryptosporidium Parvum Cdpk1, | 1e-07 | ||
| 1aj4_A | 161 | Structure Of Calcium-Saturated Cardiac Troponin C, | 4e-07 | ||
| 1dtl_A | 161 | Crystal Structure Of Calcium-Saturated (3ca2+) Card | 4e-07 | ||
| 1la0_A | 161 | Solution Structure Of Calcium Saturated Cardiac Tro | 7e-07 | ||
| 1yru_B | 74 | Crystal Structure Analysis Of The Adenylyl Cyclaes | 1e-06 | ||
| 1cmf_A | 73 | Nmr Solution Structure Of Apo Calmodulin Carboxy-Te | 1e-06 | ||
| 3hzt_A | 467 | Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 | 1e-06 | ||
| 2ro9_A | 69 | Solution Structure Of Calcium Bound Soybean Calmodu | 1e-06 | ||
| 1fw4_A | 71 | Crystal Structure Of E. Coli Fragment Tr2c From Cal | 1e-06 | ||
| 2col_B | 67 | Crystal Structure Analysis Of CyaaC-Cam With Pyroph | 1e-06 | ||
| 3khe_A | 191 | Crystal Structure Of The Calcium-Loaded Calmodulin- | 1e-06 | ||
| 3k21_A | 191 | Crystal Structure Of Carboxy-Terminus Of Pfc0420w L | 1e-06 | ||
| 2rrt_A | 72 | Solution Structure Of Magnesium-Bound Form Of Calmo | 1e-06 | ||
| 2gv5_A | 161 | Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 1 | 2e-06 | ||
| 2jt0_A | 161 | Solution Structure Of F104w Cardiac Troponin C Leng | 3e-06 | ||
| 2jt3_A | 161 | Solution Structure Of F153w Cardiac Troponin C Leng | 3e-06 | ||
| 2ami_A | 96 | Solution Structure Of The Calcium-Loaded N-Terminal | 3e-06 | ||
| 1h4b_A | 84 | Solution Structure Of The Birch Pollen Allergen Bet | 3e-06 | ||
| 3lij_A | 494 | Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) | 4e-06 | ||
| 3o4y_A | 196 | Crystal Structure Of Cad Domain Of The Plasmodium V | 4e-06 | ||
| 3l19_A | 214 | Crystal Structure Of Calcium Binding Domain Of Cpcd | 5e-06 | ||
| 2jtz_A | 161 | Solution Structure And Chemical Shift Assignments O | 9e-06 | ||
| 2jt8_A | 161 | Solution Structure Of The F153-To-5-Flurotryptophan | 9e-06 | ||
| 1f71_A | 67 | Refined Solution Structure Of Calmodulin C-Terminal | 1e-05 | ||
| 2lan_A | 167 | Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc | 1e-05 | ||
| 2kz2_A | 94 | Calmodulin, C-Terminal Domain, F92e Mutant Length = | 1e-05 | ||
| 3pm8_A | 197 | Cad Domain Of Pff0520w, Calcium Dependent Protein K | 1e-05 | ||
| 3i79_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 1e-05 | ||
| 3ox5_A | 153 | Crystal Structure Of The Calcium Sensor Calcium-Bin | 1e-05 | ||
| 3ku2_A | 507 | Crystal Structure Of Inactivated Form Of Cdpk1 From | 1e-05 | ||
| 1zot_B | 69 | Crystal Structure Analysis Of The CyaaC-Cam With Pm | 1e-05 | ||
| 3hx4_A | 508 | Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg | 1e-05 | ||
| 1s6i_A | 188 | Ca2+-Regulatory Region (Cld) From Soybean Calcium-D | 2e-05 | ||
| 1sw8_A | 79 | Solution Structure Of The N-Terminal Domain Of Huma | 4e-05 | ||
| 2opo_A | 86 | Crystal Structure Of The Calcium-Binding Pollen All | 4e-05 | ||
| 3ox6_A | 153 | Crystal Structure Of The Calcium Sensor Calcium-Bin | 5e-05 | ||
| 2k7c_A | 72 | Nmr Structure Of Mg2+-Bound Cabp1 C-Domain Length = | 8e-05 | ||
| 2lqc_A | 77 | Nmr Solution Structure Of A Ca2+-Calmodulin With A | 9e-05 | ||
| 3tz1_A | 74 | Crystal Structure Of The Ca2+-saturated C-terminal | 9e-05 | ||
| 1f70_A | 76 | Refined Solution Structure Of Calmodulin N-Terminal | 9e-05 | ||
| 3b32_A | 75 | Crystal Structure Of Calcium-Saturated Calmodulin N | 9e-05 | ||
| 1ak8_A | 76 | Nmr Solution Structure Of Cerium-Loaded Calmodulin | 9e-05 | ||
| 3uct_A | 79 | Structure Of Mn2+-Bound N-Terminal Domain Of Calmod | 9e-05 | ||
| 1j7o_A | 76 | Solution Structure Of Calcium-calmodulin N-terminal | 1e-04 | ||
| 2bl0_B | 145 | Physarum Polycephalum Myosin Ii Regulatory Domain L | 1e-04 | ||
| 3ifk_A | 90 | Crystal Structure Of Calcium-Saturated Calmodulin N | 1e-04 | ||
| 2llo_A | 80 | Solution Nmr-Derived Structure Of Calmodulin N-Lobe | 1e-04 | ||
| 2jnx_A | 134 | Nmr Derived Solution Structure Of An Ef-Hand Calciu | 1e-04 | ||
| 1ggw_A | 140 | Cdc4p From Schizosaccharomyces Pombe Length = 140 | 2e-04 | ||
| 2ksz_A | 76 | The Solution Structure Of The Magnesium Bound Soybe | 2e-04 | ||
| 2roa_A | 79 | Solution Structure Of Calcium Bound Soybean Calmodu | 2e-04 | ||
| 1zmz_A | 98 | Solution Structure Of The N-Terminal Domain (M1-S98 | 2e-04 | ||
| 1zmz_A | 98 | Solution Structure Of The N-Terminal Domain (M1-S98 | 3e-04 | ||
| 2zn8_A | 190 | Crystal Structure Of Zn2+-Bound Form Of Alg-2 Lengt | 2e-04 | ||
| 1hqv_A | 191 | Structure Of Apoptosis-Linked Protein Alg-2 Length | 3e-04 | ||
| 2zne_A | 169 | Crystal Structure Of Zn2+-Bound Form Of Des3-23alg- | 3e-04 | ||
| 2zrs_A | 168 | Crystal Structure Of Ca2+-Bound Form Of Des3-23alg- | 3e-04 | ||
| 2zn9_A | 172 | Crystal Structure Of Ca2+-bound Form Of Des3-20alg- | 3e-04 | ||
| 2i08_A | 78 | Solvation Effect In Conformational Changes Of Ef-Ha | 3e-04 | ||
| 2i08_A | 78 | Solvation Effect In Conformational Changes Of Ef-Ha | 5e-04 | ||
| 2ro8_A | 79 | Solution Structure Of Calcium Bound Soybean Calmodu | 3e-04 | ||
| 2ro8_A | 79 | Solution Structure Of Calcium Bound Soybean Calmodu | 8e-04 | ||
| 3aak_A | 172 | Crystal Structure Of Zn2+-Bound Form Of Des3-20alg- | 4e-04 | ||
| 1npq_A | 90 | Structure Of A Rhodamine-Labeled N-Domain Troponin | 4e-04 | ||
| 1avs_A | 90 | X-Ray Crystallographic Study Of Calcium-Saturated N | 5e-04 | ||
| 1qx2_A | 76 | X-Ray Structure Of Calcium-Loaded Calbindomodulin ( | 5e-04 | ||
| 3i7c_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 5e-04 | ||
| 3aaj_A | 167 | Crystal Structure Of Ca2+-Bound Form Of Des3-23alg- | 5e-04 | ||
| 2nxq_A | 134 | Crystal Structure Of Calcium Binding Protein 1 From | 6e-04 | ||
| 1jfj_A | 134 | Nmr Solution Structure Of An Ef-Hand Calcium Bindin | 7e-04 | ||
| 1trf_A | 76 | Solution Structure Of The Tr1c Fragment Of Skeletal | 8e-04 |
| >pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 | Back alignment and structure |
|
| >pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 | Back alignment and structure |
| >pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 | Back alignment and structure |
| >pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 | Back alignment and structure |
| >pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 | Back alignment and structure |
| >pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 | Back alignment and structure |
| >pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 | Back alignment and structure |
| >pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 | Back alignment and structure |
| >pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 | Back alignment and structure |
| >pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 | Back alignment and structure |
| >pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 | Back alignment and structure |
| >pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 | Back alignment and structure |
| >pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 | Back alignment and structure |
| >pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 | Back alignment and structure |
| >pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 | Back alignment and structure |
| >pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 | Back alignment and structure |
| >pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 | Back alignment and structure |
| >pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 | Back alignment and structure |
| >pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 | Back alignment and structure |
| >pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 | Back alignment and structure |
| >pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 | Back alignment and structure |
| >pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 | Back alignment and structure |
| >pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 | Back alignment and structure |
| >pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 | Back alignment and structure |
| >pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 | Back alignment and structure |
| >pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 | Back alignment and structure |
| >pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 | Back alignment and structure |
| >pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 | Back alignment and structure |
| >pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 | Back alignment and structure |
| >pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 | Back alignment and structure |
| >pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 | Back alignment and structure |
| >pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 | Back alignment and structure |
| >pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 | Back alignment and structure |
| >pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 | Back alignment and structure |
| >pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 | Back alignment and structure |
| >pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 | Back alignment and structure |
| >pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 | Back alignment and structure |
| >pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 | Back alignment and structure |
| >pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 | Back alignment and structure |
| >pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 | Back alignment and structure |
| >pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 | Back alignment and structure |
| >pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 | Back alignment and structure |
| >pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 | Back alignment and structure |
| >pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 | Back alignment and structure |
| >pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 | Back alignment and structure |
| >pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 | Back alignment and structure |
| >pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 | Back alignment and structure |
| >pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 | Back alignment and structure |
| >pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 | Back alignment and structure |
| >pdb|2OBH|A Chain A, Centrin-Xpc Peptide Length = 143 | Back alignment and structure |
| >pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 | Back alignment and structure |
| >pdb|1XFX|O Chain O, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride Length = 149 | Back alignment and structure |
| >pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 | Back alignment and structure |
| >pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 | Back alignment and structure |
| >pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 | Back alignment and structure |
| >pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 | Back alignment and structure |
| >pdb|3QRX|A Chain A, Chlamydomonas Reinhardtii Centrin Bound To Melittin Length = 169 | Back alignment and structure |
| >pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 | Back alignment and structure |
| >pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 | Back alignment and structure |
| >pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 | Back alignment and structure |
| >pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 | Back alignment and structure |
| >pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 | Back alignment and structure |
| >pdb|2LHI|A Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam Length = 176 | Back alignment and structure |
| >pdb|1LKJ|A Chain A, Nmr Structure Of Apo Calmodulin From Yeast Saccharomyces Cerevisiae Length = 146 | Back alignment and structure |
| >pdb|4DS7|A Chain A, Crystal Structure Of Yeast Calmodulin Bound To The C-Terminal Fragment Of Spindle Pole Body Protein Spc110 Length = 147 | Back alignment and structure |
| >pdb|2LHH|A Chain A, Solution Structure Of Ca2+-Bound Ycam Length = 128 | Back alignment and structure |
| >pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 | Back alignment and structure |
| >pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 | Back alignment and structure |
| >pdb|2LMT|A Chain A, Nmr Structure Of Androcam Length = 148 | Back alignment and structure |
| >pdb|2KN2|A Chain A, Solution Structure Of The C-Terminal Domain Of Soybean Calmodulin Isoform 4 Fused With The Calmodulin-Binding Domain Of Ntmkp1 Length = 92 | Back alignment and structure |
| >pdb|2ROB|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 C-Terminal Domain Length = 70 | Back alignment and structure |
| >pdb|2KXW|A Chain A, Structure Of The C-Domain Fragment Of Apo Calmodulin Bound To The Iq Motif Of Nav1.2 Length = 73 | Back alignment and structure |
| >pdb|3FWB|A Chain A, Sac3:sus1:cdc31 Complex Length = 161 | Back alignment and structure |
| >pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 | Back alignment and structure |
| >pdb|1AJ4|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 1 Structure Length = 161 | Back alignment and structure |
| >pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 | Back alignment and structure |
| >pdb|1LA0|A Chain A, Solution Structure Of Calcium Saturated Cardiac Troponin C In The Troponin C-Troponin I Complex Length = 161 | Back alignment and structure |
| >pdb|1YRU|B Chain B, Crystal Structure Analysis Of The Adenylyl Cyclaes Catalytic Domain Of Adenylyl Cyclase Toxin Of Bordetella Pertussis In Presence Of C-Terminal Calmodulin And 1mm Calcium Chloride Length = 74 | Back alignment and structure |
| >pdb|1CMF|A Chain A, Nmr Solution Structure Of Apo Calmodulin Carboxy-Terminal Domain Length = 73 | Back alignment and structure |
| >pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 | Back alignment and structure |
| >pdb|2RO9|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 C-Terminal Domain Length = 69 | Back alignment and structure |
| >pdb|1FW4|A Chain A, Crystal Structure Of E. Coli Fragment Tr2c From Calmodulin To 1.7 A Resolution Length = 71 | Back alignment and structure |
| >pdb|2COL|B Chain B, Crystal Structure Analysis Of CyaaC-Cam With Pyrophosphate Length = 67 | Back alignment and structure |
| >pdb|3KHE|A Chain A, Crystal Structure Of The Calcium-Loaded Calmodulin-Like Domain Of The Cdpk, 541.M00134 From Toxoplasma Gondii Length = 191 | Back alignment and structure |
| >pdb|3K21|A Chain A, Crystal Structure Of Carboxy-Terminus Of Pfc0420w Length = 191 | Back alignment and structure |
| >pdb|2RRT|A Chain A, Solution Structure Of Magnesium-Bound Form Of Calmodulin C-Domain E104dE140D MUTANT Length = 72 | Back alignment and structure |
| >pdb|2GV5|A Chain A, Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 161 | Back alignment and structure |
| >pdb|2JT0|A Chain A, Solution Structure Of F104w Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|2AMI|A Chain A, Solution Structure Of The Calcium-Loaded N-Terminal Sensor Domain Of Centrin Length = 96 | Back alignment and structure |
| >pdb|1H4B|A Chain A, Solution Structure Of The Birch Pollen Allergen Bet V 4 Length = 84 | Back alignment and structure |
| >pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 | Back alignment and structure |
| >pdb|3O4Y|A Chain A, Crystal Structure Of Cad Domain Of The Plasmodium Vivax Cdpk, Pvx_11610 Length = 196 | Back alignment and structure |
| >pdb|3L19|A Chain A, Crystal Structure Of Calcium Binding Domain Of Cpcdpk3, Cgd5_820 Length = 214 | Back alignment and structure |
| >pdb|2JTZ|A Chain A, Solution Structure And Chemical Shift Assignments Of The F104-To-5-Flurotryptophan Mutant Of Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 | Back alignment and structure |
| >pdb|1F71|A Chain A, Refined Solution Structure Of Calmodulin C-Terminal Domain Length = 67 | Back alignment and structure |
| >pdb|2LAN|A Chain A, Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc Length = 167 | Back alignment and structure |
| >pdb|2KZ2|A Chain A, Calmodulin, C-Terminal Domain, F92e Mutant Length = 94 | Back alignment and structure |
| >pdb|3PM8|A Chain A, Cad Domain Of Pff0520w, Calcium Dependent Protein Kinase Length = 197 | Back alignment and structure |
| >pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 | Back alignment and structure |
| >pdb|3OX5|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 | Back alignment and structure |
| >pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 | Back alignment and structure |
| >pdb|1ZOT|B Chain B, Crystal Structure Analysis Of The CyaaC-Cam With Pmeapp Length = 69 | Back alignment and structure |
| >pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 | Back alignment and structure |
| >pdb|1S6I|A Chain A, Ca2+-Regulatory Region (Cld) From Soybean Calcium-Dependent Protein Kinase-Alpha (Cdpk) In The Presence Of Ca2+ And The Junction Domain (Jd) Length = 188 | Back alignment and structure |
| >pdb|1SW8|A Chain A, Solution Structure Of The N-Terminal Domain Of Human N60d Calmodulin Refined With Paramagnetism Based Strategy Length = 79 | Back alignment and structure |
| >pdb|2OPO|A Chain A, Crystal Structure Of The Calcium-Binding Pollen Allergen Che A 3 Length = 86 | Back alignment and structure |
| >pdb|3OX6|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 | Back alignment and structure |
| >pdb|2K7C|A Chain A, Nmr Structure Of Mg2+-Bound Cabp1 C-Domain Length = 72 | Back alignment and structure |
| >pdb|2LQC|A Chain A, Nmr Solution Structure Of A Ca2+-Calmodulin With A Binding Motif (Nscate) Peptide From The N-Terminal Cytoplasmic Domain Of The L-Type Voltage-Cated Calcium Channel Alpha1c Subunit Length = 77 | Back alignment and structure |
| >pdb|3TZ1|A Chain A, Crystal Structure Of The Ca2+-saturated C-terminal Domain Of Akazara Scallop Troponin C In Complex With A Troponin I Fragment Length = 74 | Back alignment and structure |
| >pdb|1F70|A Chain A, Refined Solution Structure Of Calmodulin N-Terminal Domain Length = 76 | Back alignment and structure |
| >pdb|3B32|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75 Length = 75 | Back alignment and structure |
| >pdb|1AK8|A Chain A, Nmr Solution Structure Of Cerium-Loaded Calmodulin Amino- Terminal Domain (Ce2-Tr1c), 23 Structures Length = 76 | Back alignment and structure |
| >pdb|3UCT|A Chain A, Structure Of Mn2+-Bound N-Terminal Domain Of Calmodulin In The Presence Of Zn2+ Length = 79 | Back alignment and structure |
| >pdb|1J7O|A Chain A, Solution Structure Of Calcium-calmodulin N-terminal Domain Length = 76 | Back alignment and structure |
| >pdb|2BL0|B Chain B, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 145 | Back alignment and structure |
| >pdb|3IFK|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-90 Length = 90 | Back alignment and structure |
| >pdb|2LLO|A Chain A, Solution Nmr-Derived Structure Of Calmodulin N-Lobe Bound With Er Alpha Peptide Length = 80 | Back alignment and structure |
| >pdb|2JNX|A Chain A, Nmr Derived Solution Structure Of An Ef-Hand Calcium Binding Protein From Entamoeba Histolytica Length = 134 | Back alignment and structure |
| >pdb|1GGW|A Chain A, Cdc4p From Schizosaccharomyces Pombe Length = 140 | Back alignment and structure |
| >pdb|2KSZ|A Chain A, The Solution Structure Of The Magnesium Bound Soybean Calmod Isoform 4 N-Domain Length = 76 | Back alignment and structure |
| >pdb|2ROA|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 N-Terminal Domain Length = 79 | Back alignment and structure |
| >pdb|1ZMZ|A Chain A, Solution Structure Of The N-Terminal Domain (M1-S98) Of Human Centrin 2 Length = 98 | Back alignment and structure |
| >pdb|1ZMZ|A Chain A, Solution Structure Of The N-Terminal Domain (M1-S98) Of Human Centrin 2 Length = 98 | Back alignment and structure |
| >pdb|2ZN8|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Alg-2 Length = 190 | Back alignment and structure |
| >pdb|1HQV|A Chain A, Structure Of Apoptosis-Linked Protein Alg-2 Length = 191 | Back alignment and structure |
| >pdb|2ZNE|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Des3-23alg-2 Complexed With Alix Abs Peptide Length = 169 | Back alignment and structure |
| >pdb|2ZRS|A Chain A, Crystal Structure Of Ca2+-Bound Form Of Des3-23alg-2 Length = 168 | Back alignment and structure |
| >pdb|2ZN9|A Chain A, Crystal Structure Of Ca2+-bound Form Of Des3-20alg-2 Length = 172 | Back alignment and structure |
| >pdb|2I08|A Chain A, Solvation Effect In Conformational Changes Of Ef-Hand Proteins: X-Ray Structure Of Ca2+-Saturated Double Mutant Q41l-K75i Of N-Domain Of Calmodulin Length = 78 | Back alignment and structure |
| >pdb|2I08|A Chain A, Solvation Effect In Conformational Changes Of Ef-Hand Proteins: X-Ray Structure Of Ca2+-Saturated Double Mutant Q41l-K75i Of N-Domain Of Calmodulin Length = 78 | Back alignment and structure |
| >pdb|2RO8|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 N-Terminal Domain Length = 79 | Back alignment and structure |
| >pdb|2RO8|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 N-Terminal Domain Length = 79 | Back alignment and structure |
| >pdb|3AAK|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Des3-20alg-2f122a Length = 172 | Back alignment and structure |
| >pdb|1NPQ|A Chain A, Structure Of A Rhodamine-Labeled N-Domain Troponin C Mutant (Ca2+ Saturated) In Complex With Skeletal Troponin I 115- 131 Length = 90 | Back alignment and structure |
| >pdb|1AVS|A Chain A, X-Ray Crystallographic Study Of Calcium-Saturated N- Terminal Domain Of Troponin C Length = 90 | Back alignment and structure |
| >pdb|1QX2|A Chain A, X-Ray Structure Of Calcium-Loaded Calbindomodulin (A Calbindin D9k Re- Engineered To Undergo A Conformational Opening) At 1.44 A Resolution Length = 76 | Back alignment and structure |
| >pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 | Back alignment and structure |
| >pdb|3AAJ|A Chain A, Crystal Structure Of Ca2+-Bound Form Of Des3-23alg-2deltagf122 Length = 167 | Back alignment and structure |
| >pdb|2NXQ|A Chain A, Crystal Structure Of Calcium Binding Protein 1 From Entamoeba Histolytica: A Novel Arrangement Of Ef Hand Motifs Length = 134 | Back alignment and structure |
| >pdb|1JFJ|A Chain A, Nmr Solution Structure Of An Ef-Hand Calcium Binding Protein From Entamoeba Histolytica Length = 134 | Back alignment and structure |
| >pdb|1TRF|A Chain A, Solution Structure Of The Tr1c Fragment Of Skeletal Muscle Troponin-C Length = 76 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 212 | |||
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 4e-32 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 2e-14 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 6e-07 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 2e-31 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 1e-29 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 3e-13 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 2e-29 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 1e-08 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 5e-29 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 1e-28 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 3e-28 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 8e-07 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 3e-28 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 4e-28 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 3e-15 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 4e-28 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 9e-28 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 1e-27 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 2e-27 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 3e-27 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 4e-27 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 1e-26 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 2e-11 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 1e-26 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 9e-11 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 2e-26 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 2e-16 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 2e-08 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 4e-26 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 2e-12 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 9e-26 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 6e-06 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 1e-25 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 1e-25 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 4e-05 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 2e-25 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 3e-15 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 2e-25 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 5e-25 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 2e-20 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 1e-24 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 1e-07 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 3e-24 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 2e-10 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 3e-24 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 5e-24 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 2e-14 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 5e-06 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 8e-24 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 2e-10 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 8e-24 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 4e-07 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 1e-23 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 1e-06 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 2e-23 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 3e-23 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 7e-05 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 6e-23 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 2e-05 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 8e-23 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 9e-23 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 3e-04 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 1e-22 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 1e-22 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 5e-07 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 1e-22 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 7e-10 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 5e-06 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 2e-22 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 2e-21 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 2e-09 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 4e-21 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 5e-09 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 5e-21 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 7e-21 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 2e-20 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 2e-08 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 2e-20 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 9e-09 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 4e-20 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 1e-17 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 5e-20 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 9e-09 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 9e-20 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 2e-19 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 5e-10 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 3e-19 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 3e-08 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 3e-19 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 1e-07 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 4e-19 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 7e-19 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 3e-13 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 9e-19 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 3e-08 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 2e-18 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 1e-09 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 2e-18 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 9e-09 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 4e-18 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 3e-08 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 9e-18 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 1e-17 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 1e-17 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 2e-08 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 3e-17 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 1e-07 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 3e-17 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 9e-17 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 1e-07 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 1e-16 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 5e-05 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 8e-04 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 1e-16 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 1e-16 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 3e-07 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 1e-16 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 3e-06 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 8e-05 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 2e-16 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 3e-07 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 2e-16 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 4e-07 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 2e-16 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 2e-16 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 7e-08 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 2e-16 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 3e-08 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 4e-16 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 6e-08 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 4e-16 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 2e-07 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 1e-15 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 1e-07 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 1e-15 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 3e-06 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 2e-15 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 2e-04 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 4e-15 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 7e-06 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 5e-15 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 3e-08 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 6e-15 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 8e-12 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 2e-14 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 5e-07 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 2e-14 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 2e-09 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 7e-14 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 2e-07 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 8e-14 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 4e-06 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 2e-04 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 1e-13 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 4e-04 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 9e-13 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 1e-09 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 2e-04 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 4e-12 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 7e-08 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 1e-11 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 2e-08 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 3e-04 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 6e-11 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 1e-10 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 1e-10 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 5e-05 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 2e-10 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 2e-04 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 6e-10 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 3e-04 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 1e-09 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 2e-09 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 6e-09 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 2e-08 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 2e-08 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 2e-08 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 2e-08 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 2e-08 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 4e-08 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 5e-08 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 2e-07 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 4e-07 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 5e-07 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 1e-06 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 3e-06 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 6e-06 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 2e-05 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 2e-04 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 2e-04 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 7e-04 |
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
Score = 112 bits (282), Expect = 4e-32
Identities = 32/133 (24%), Positives = 55/133 (41%), Gaps = 17/133 (12%)
Query: 87 KLLDRDNDGVVLRSELEALLIRLGADPPTQEEVKSMLSEVDREGDGRV-----------G 135
K +D + DG V E++A + + A ++ ++ + +D +G+G +
Sbjct: 7 KEIDVNGDGAVSYEEVKAFVSKKRAIK-NEQLLQLIFKSIDADGNGEIDQNEFAKFYGSI 65
Query: 136 NSSCEPACEPELKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNG 195
+ LK + D D DGK+T EE+ F K G E + D NG
Sbjct: 66 QGQDLSDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIE-----KVAEQVMKADANG 120
Query: 196 DGFVCFEDFSRMM 208
DG++ E+F
Sbjct: 121 DGYITLEEFLEFS 133
|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 212 | |||
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.96 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.95 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.95 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.95 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.94 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.94 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.94 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.93 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.93 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.93 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.93 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.93 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.93 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 99.93 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 99.92 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.92 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.92 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.92 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 99.92 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.92 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.92 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.92 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.92 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.92 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.91 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.91 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.91 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.91 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.91 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.91 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.9 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.9 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 99.9 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.9 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.9 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.9 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.9 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.9 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.9 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.9 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.89 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.89 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.89 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.89 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.89 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.88 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.88 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.88 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.88 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.88 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 99.87 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 99.87 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 99.87 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.87 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.87 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 99.87 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.87 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.87 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.87 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.86 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 99.86 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.86 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.86 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.85 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.85 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 99.85 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.85 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.85 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.85 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.84 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.84 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.84 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 99.84 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.84 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.83 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.83 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.83 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.83 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.83 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 99.83 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.83 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.82 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.82 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.82 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.82 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 99.81 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.81 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.8 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.78 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 99.73 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 99.72 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.72 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.72 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.72 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.71 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 99.7 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.69 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 99.69 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.68 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.68 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.64 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.63 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 99.61 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.61 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 99.59 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.58 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.57 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.55 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.55 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 99.53 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.53 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.53 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.52 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.5 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 99.5 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 99.49 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 99.49 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.49 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.48 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 99.48 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.48 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 99.47 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.47 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.46 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 99.45 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.45 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.45 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.45 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 99.44 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 99.44 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 99.44 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.44 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 99.44 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 99.43 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 99.43 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 99.43 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 99.43 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 99.43 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 99.42 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 99.41 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 99.41 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.4 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 99.4 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 99.39 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 99.39 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.39 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 99.39 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 99.39 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.38 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 99.38 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 99.37 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 99.37 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 99.37 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.36 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 99.36 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 99.36 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 99.36 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 99.36 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 99.35 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 99.35 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 99.34 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 99.34 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 99.33 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.33 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 99.33 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 99.32 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 99.32 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 99.32 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.32 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.32 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 99.31 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 99.31 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 99.3 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 99.3 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.29 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 99.28 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 99.28 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.28 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.28 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.27 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 99.27 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 99.27 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.26 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 99.25 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 99.25 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 99.25 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.25 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 99.24 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.24 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.24 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 99.24 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 99.24 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.23 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 99.23 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 99.23 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 99.22 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 99.22 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.22 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.22 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.22 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.21 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.2 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.2 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.2 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.2 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.2 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.19 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.19 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.18 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 99.18 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 99.18 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.17 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 99.17 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.17 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 99.17 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 99.17 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.16 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.15 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.15 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.15 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 99.15 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 99.14 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.14 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.13 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.13 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.13 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.13 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.13 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.12 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 99.12 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.11 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.11 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.11 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.09 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.09 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.09 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.09 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.09 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 99.08 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.08 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.08 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.07 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 99.07 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 99.06 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 99.06 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 99.05 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 99.05 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 99.05 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 99.05 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.05 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.04 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.03 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 99.03 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.03 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 99.03 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.02 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.02 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.02 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 99.02 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 99.01 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 99.01 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 99.01 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 99.0 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 98.99 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 98.98 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 98.98 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 98.98 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 98.98 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 98.97 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 98.97 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.95 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 98.95 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 98.93 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 98.93 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 98.93 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 98.92 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 98.92 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 98.91 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.91 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 98.91 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 98.91 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 98.9 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 98.9 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 98.89 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.89 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 98.89 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 98.89 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 98.87 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 98.87 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 98.87 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 98.85 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 98.85 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 98.84 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 98.83 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 98.83 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 98.82 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 98.8 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 98.79 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 98.78 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 98.77 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 98.76 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 98.74 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 98.73 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 98.69 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 98.66 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.55 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 98.3 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 98.26 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 98.2 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.19 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 98.18 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 97.82 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 97.75 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 97.7 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 97.07 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 96.94 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 96.91 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 95.54 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 95.49 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 95.45 | |
| 1wlm_A | 151 | Protein CGI-38; structural genomics, NPPSFA, natio | 95.22 | |
| 2jrf_A | 184 | Tubulin polymerization-promoting protein family me | 94.96 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 94.21 | |
| 2l5y_A | 150 | Stromal interaction molecule 2; EF-hand, SAM domai | 93.97 | |
| 2l5y_A | 150 | Stromal interaction molecule 2; EF-hand, SAM domai | 93.9 | |
| 4dck_A | 168 | Sodium channel protein type 5 subunit alpha; IQ-mo | 93.39 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 93.22 | |
| 2k60_A | 150 | Protein (stromal interaction molecule 1); EF-hand, | 93.1 | |
| 4fl4_A | 88 | Glycoside hydrolase family 9; structural genomics, | 91.13 | |
| 3tdu_A | 200 | DCN1-like protein 1; E2:E3, ligase-protein binding | 90.83 | |
| 4dh2_B | 82 | Dockerin type 1; cellulosome, cohesin, type I cohe | 90.31 | |
| 2k60_A | 150 | Protein (stromal interaction molecule 1); EF-hand, | 89.96 | |
| 3kev_A | 199 | Galieria sulfuraria DCUN1 domain-containing prote; | 89.72 | |
| 4dck_A | 168 | Sodium channel protein type 5 subunit alpha; IQ-mo | 89.3 | |
| 2ccl_B | 63 | Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d | 88.82 | |
| 4gba_A | 221 | DCN1-like protein 3; E3 ligase, ligase-peptide com | 88.72 | |
| 3kev_A | 199 | Galieria sulfuraria DCUN1 domain-containing prote; | 85.36 | |
| 3ul4_B | 65 | Cellulosome enzyme, dockerin type I; cohesin, type | 83.63 | |
| 3tdu_A | 200 | DCN1-like protein 1; E2:E3, ligase-protein binding | 82.3 | |
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 81.4 | |
| 2vn6_B | 64 | Endoglucanase A; cell adhesion, carbohydrate metab | 81.17 | |
| 2y3n_B | 71 | Cellulosomal family-48 processive glycoside hydro; | 80.02 |
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
Probab=99.96 E-value=1.1e-28 Score=181.04 Aligned_cols=137 Identities=29% Similarity=0.528 Sum_probs=128.0
Q ss_pred cCCHHHHHHHHHHHHHhcCCCCCcccHHHHHHHHHHhCCCCCCHHHHHHHHHhhcCCCCcccccCCC---------CCCC
Q 028192 73 DISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEVKSMLSEVDREGDGRVGNSSC---------EPAC 143 (212)
Q Consensus 73 ~~t~~~~~~l~~~F~~~D~d~~G~I~~~el~~~l~~l~~~~~s~~~~~~l~~~~d~~~~g~i~~~e~---------~~~~ 143 (212)
.||++++++|+++|..+|.|++|.|+..||..+++.+|.. ++..++..++..+|.+++|.|+|.+| ....
T Consensus 3 ~lt~eqi~el~~~F~~~D~d~~G~I~~~El~~~l~~~~~~-~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~~~~~~~~ 81 (148)
T 2lmt_A 3 ELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQN-PTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDT 81 (148)
T ss_dssp SCCSHHHHHHHHHHHHHHCSSCCEEEGGGHHHHHHHHTCC-CCHHHHHHHHHHHHTTSTTEEEHHHHHHHHHHTTTTTTT
T ss_pred CCCHHHHHHHHHHHHHHcCCCCCeECHHHHHHHHHhcCCC-chHHHHHHHHHhcccCCCCcccHHHHHHHHHHHhcccCc
Confidence 3677999999999999999999999999999999999997 99999999999999999999999865 3345
Q ss_pred hhHHHHHHHhhcCCCCCccCHHHHHHHHHHhCCCCCCHHHHHHHHHHhcCCCCcceeHHHHHHHHHhC
Q 028192 144 EPELKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMMELQ 211 (212)
Q Consensus 144 ~~~l~~~F~~~D~d~~G~I~~~El~~~l~~~g~~~ls~~~~~~l~~~~d~~~dg~I~~~eF~~~l~~~ 211 (212)
.+.+..+|+.||.|++|+|+.+||+.+|..+|. .++++++..++..+|.|++|.|+|+||+.+|.++
T Consensus 82 ~~~l~~aF~~~D~d~~G~I~~~El~~~l~~~g~-~~~~~e~~~l~~~~D~d~dG~I~~~EF~~~m~~K 148 (148)
T 2lmt_A 82 EEEMREAFKIFDRDGDGFISPAELRFVMINLGE-KVTDEEIDEMIREADFDGDGMINYEEFVWMISQK 148 (148)
T ss_dssp HHHHHHHHHHHHSSCSSEECHHHHHHHHHHHTC-CCCHHHHHHHHHHHCCSCCSSEEHHHHHHHHTTC
T ss_pred HHHHHHHHHHHCCCCcCcCcHHHHHHHHHHcCc-cccHHHHHHHHHHhCCCCCCeEeHHHHHHHHhcC
Confidence 678999999999999999999999999999995 8999999999999999999999999999998763
|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A | Back alignment and structure |
|---|
| >3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* | Back alignment and structure |
|---|
| >4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B | Back alignment and structure |
|---|
| >4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >3ul4_B Cellulosome enzyme, dockerin type I; cohesin, type I cohesin-dockerin COMP protein-protein interaction, cell adhesion; HET: PEG; 1.95A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* | Back alignment and structure |
|---|
| >2vn6_B Endoglucanase A; cell adhesion, carbohydrate metabolism, polysaccharide degradation, hydrolase, glycosidase, cellulose degradation; 1.49A {Clostridium cellulolyticum} PDB: 2vn5_B | Back alignment and structure |
|---|
| >2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 212 | ||||
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 8e-17 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 2e-06 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 3e-04 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-16 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 1e-15 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 5e-06 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 0.003 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 1e-15 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 1e-08 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 2e-14 | |
| d1dtla_ | 156 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 3e-14 | |
| d1dtla_ | 156 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 4e-04 | |
| d1w7jb1 | 139 | a.39.1.5 (B:11-149) Myosin Essential Chain {Human | 5e-14 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 2e-13 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 2e-06 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 0.001 | |
| d1k94a_ | 165 | a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta | 2e-13 | |
| d1k94a_ | 165 | a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta | 6e-09 | |
| d1k94a_ | 165 | a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta | 2e-04 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 5e-13 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 7e-05 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 7e-13 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 4e-08 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 1e-06 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 7e-04 | |
| d1qxpa2 | 188 | a.39.1.8 (A:515-702) Calpain large subunit, C-term | 7e-13 | |
| d1qxpa2 | 188 | a.39.1.8 (A:515-702) Calpain large subunit, C-term | 9e-05 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 9e-13 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 1e-04 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 1e-12 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 2e-05 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-12 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 2e-04 | |
| d1jbaa_ | 189 | a.39.1.5 (A:) Guanylate cyclase activating protein | 2e-12 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 3e-12 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 4e-04 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 3e-12 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 2e-04 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 0.001 | |
| d1fpwa_ | 190 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 9e-12 | |
| d1fpwa_ | 190 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 5e-04 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 9e-12 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 0.002 | |
| d1juoa_ | 172 | a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: | 2e-11 | |
| d1juoa_ | 172 | a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: | 2e-09 | |
| d1juoa_ | 172 | a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: | 8e-04 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 2e-11 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 3e-05 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 2e-11 | |
| d1fw4a_ | 65 | a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: | 4e-11 | |
| d1fw4a_ | 65 | a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: | 0.001 | |
| d1fw4a_ | 65 | a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: | 0.003 | |
| d1g8ia_ | 187 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 4e-11 | |
| d1g8ia_ | 187 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 4e-04 | |
| d1s6ca_ | 178 | a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera | 5e-11 | |
| d1s6ca_ | 178 | a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera | 8e-05 | |
| d1wrka1 | 82 | a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) | 7e-11 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 8e-11 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 2e-04 | |
| d1f54a_ | 77 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 1e-10 | |
| d1f54a_ | 77 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 9e-05 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 1e-10 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 4e-04 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 0.004 | |
| d1cb1a_ | 78 | a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax | 1e-10 | |
| d1cb1a_ | 78 | a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax | 4e-04 | |
| d1nyaa_ | 176 | a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth | 2e-10 | |
| d1nyaa_ | 176 | a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth | 3e-06 | |
| d1qx2a_ | 76 | a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax | 3e-10 | |
| d1qx2a_ | 76 | a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax | 0.004 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 3e-10 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 2e-04 | |
| d2sasa_ | 185 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 4e-10 | |
| d2sasa_ | 185 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 1e-05 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 5e-10 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 2e-04 | |
| d1df0a1 | 186 | a.39.1.8 (A:515-700) Calpain large subunit, C-term | 5e-10 | |
| d2fcea1 | 61 | a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ | 9e-10 | |
| d2fcea1 | 61 | a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ | 1e-05 | |
| d1snla_ | 99 | a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo | 1e-09 | |
| d1snla_ | 99 | a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo | 5e-05 | |
| d1uhka1 | 187 | a.39.1.5 (A:3-189) Calcium-regulated photoprotein | 1e-09 | |
| d1m45a_ | 146 | a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye | 2e-09 | |
| d1jfja_ | 134 | a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly | 2e-09 | |
| d2scpa_ | 174 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 2e-09 | |
| d3c1va1 | 93 | a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa | 3e-09 | |
| d3c1va1 | 93 | a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa | 0.002 | |
| d1a4pa_ | 92 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 4e-09 | |
| d1yuta1 | 98 | a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa | 4e-09 | |
| d1alva_ | 173 | a.39.1.8 (A:) Calpain small (regulatory) subunit ( | 5e-09 | |
| d1alva_ | 173 | a.39.1.8 (A:) Calpain small (regulatory) subunit ( | 9e-07 | |
| d1alva_ | 173 | a.39.1.8 (A:) Calpain small (regulatory) subunit ( | 0.004 | |
| d1omra_ | 201 | a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: | 6e-09 | |
| d1omra_ | 201 | a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: | 7e-04 | |
| d2zfda1 | 183 | a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { | 2e-08 | |
| d1wdcb_ | 142 | a.39.1.5 (B:) Myosin Essential Chain {Bay scallop | 3e-08 | |
| d1psra_ | 100 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 3e-08 | |
| d1qv0a_ | 189 | a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr | 3e-08 | |
| d1ksoa_ | 93 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 9e-08 | |
| d1ksoa_ | 93 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 0.001 | |
| d1zfsa1 | 93 | a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no | 1e-07 | |
| d1hqva_ | 181 | a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous | 2e-07 | |
| d1wlza1 | 83 | a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H | 2e-07 | |
| d1xk4a1 | 87 | a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa | 3e-07 | |
| d1xk4a1 | 87 | a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa | 7e-04 | |
| d1ggwa_ | 140 | a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo | 3e-07 | |
| d1ggwa_ | 140 | a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo | 6e-04 | |
| d1wdcc_ | 152 | a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop | 4e-07 | |
| d1c07a_ | 95 | a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: | 4e-07 | |
| d1s6ia_ | 182 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 4e-07 | |
| d1s6ia_ | 182 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 4e-05 | |
| d1xo5a_ | 180 | a.39.1.5 (A:) Calcium- and integrin-binding protei | 5e-07 | |
| d1y1xa_ | 182 | a.39.1.8 (A:) Programmed cell death 6 protein-like | 8e-07 | |
| d1k8ua_ | 89 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 1e-06 | |
| d2hf5a1 | 33 | a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien | 2e-06 | |
| d1qjta_ | 99 | a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: | 9e-06 | |
| d2zkmx1 | 170 | a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human | 1e-05 | |
| d2zkmx1 | 170 | a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human | 0.004 | |
| d1fi6a_ | 92 | a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: | 1e-05 | |
| d1auib_ | 165 | a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch | 2e-05 | |
| d2jxca1 | 95 | a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ | 4e-05 | |
| d1e8aa_ | 87 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 4e-04 | |
| d1iq3a_ | 110 | a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 | 4e-04 |
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Calmodulin-like domain: Calmodulin species: Human (Homo sapiens) [TaxId: 9606]
Score = 71.9 bits (175), Expect = 8e-17
Identities = 45/137 (32%), Positives = 71/137 (51%), Gaps = 11/137 (8%)
Query: 81 ELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEVKSMLSEVDREGDGRVGNSSCE 140
E+ +A L D D G + EL+ + LG P +EE+K M+SE+D+EG G++
Sbjct: 7 EIREAFDLFDADGTGTIDVKELKVAMRALG-FEPKKEEIKKMISEIDKEGTGKMNFGDFL 65
Query: 141 PACEP---------ELKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALV 191
E+ + F FD D GKI+ + L V +LG+ L T ++ + MI
Sbjct: 66 TVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENL-TDEELQEMIDEA 124
Query: 192 DKNGDGFVCFEDFSRMM 208
D++GDG V ++F R+M
Sbjct: 125 DRDGDGEVSEQEFLRIM 141
|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 212 | |||
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.94 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.94 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.93 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.93 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.92 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.92 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 99.92 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.92 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.92 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.9 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.9 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 99.9 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.89 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.89 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 99.87 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 99.87 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.87 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.85 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.85 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.84 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.83 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.83 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.83 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 99.83 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.83 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.82 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.82 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.81 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 99.8 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 99.8 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 99.8 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 99.8 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 99.78 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 99.77 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.75 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 99.75 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.74 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.68 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.67 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.67 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.65 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.64 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.63 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 99.62 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.62 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.61 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.6 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.6 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.6 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.59 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.58 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.58 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.57 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.53 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.52 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.5 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.5 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.49 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 99.48 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.47 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.47 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.46 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 99.45 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.41 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.37 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.35 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.32 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.32 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 99.32 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.3 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.3 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 99.29 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.28 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.28 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.26 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 99.25 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.25 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.25 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 99.24 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.24 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.23 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 99.23 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.23 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 99.23 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 99.22 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.21 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.18 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.18 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 99.15 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.14 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 99.14 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.12 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.12 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.12 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 99.12 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 99.1 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 99.08 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.07 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.05 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 99.05 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.04 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 99.04 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.04 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 99.04 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 99.03 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.03 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 99.02 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.01 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.0 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 98.98 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 98.98 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.97 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.97 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 98.96 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.93 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.92 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 98.91 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 98.87 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 98.84 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 98.83 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 98.81 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.81 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 98.8 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.8 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.8 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.79 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 98.78 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 98.78 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 98.77 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 98.76 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 98.76 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 98.76 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 98.75 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.74 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 98.73 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.71 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 98.7 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 98.69 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 98.67 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 98.64 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 98.62 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.61 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.61 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 98.6 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.56 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 98.53 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 98.49 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.48 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 98.42 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.35 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 98.27 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 98.1 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 97.88 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 97.84 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 97.76 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 97.7 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 97.5 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 97.48 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 97.43 | |
| d1h8ba_ | 73 | alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | 96.17 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 95.95 | |
| d1eg3a2 | 97 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 95.01 | |
| d1j7qa_ | 86 | Calcium vector protein {Amphioxus (Branchiostoma l | 94.73 | |
| d1wlma1 | 138 | Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 | 93.12 | |
| d1pula1 | 103 | Hypothetical protein c32e8.3 {Caenorhabditis elega | 92.85 | |
| d2cclb1 | 59 | Endo-1,4-beta-xylanase Y {Clostridium thermocellum | 92.12 | |
| d1j7qa_ | 86 | Calcium vector protein {Amphioxus (Branchiostoma l | 92.0 | |
| d1dava_ | 71 | Cellulosome endoglucanase SS {Clostridium thermoce | 85.94 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 85.85 |
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Calmodulin-like domain: Calmodulin species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.94 E-value=2.4e-26 Score=166.51 Aligned_cols=136 Identities=30% Similarity=0.524 Sum_probs=125.9
Q ss_pred ccCCHHHHHHHHHHHHHhcCCCCCcccHHHHHHHHHHhCCCCCCHHHHHHHHHhhcCCCCcccccCCC---------CCC
Q 028192 72 ADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEVKSMLSEVDREGDGRVGNSSC---------EPA 142 (212)
Q Consensus 72 ~~~t~~~~~~l~~~F~~~D~d~~G~I~~~el~~~l~~l~~~~~s~~~~~~l~~~~d~~~~g~i~~~e~---------~~~ 142 (212)
.++|++++.+|+++|..+|.|++|+|+..||..+|...|.. ++...+..++..++.++.+.++|.++ ...
T Consensus 2 ~~ls~~~i~~l~~~F~~~D~d~~G~i~~~e~~~~l~~~g~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (146)
T d1lkja_ 2 SNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLS-PSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLKSND 80 (146)
T ss_dssp CCCCHHHHHHHHHHHHHHCCSSSSEEEHHHHHHHHHHHTCC-CCHHHHHHHHHHHCSSSCCEEEHHHHHHHHHHHTCCCC
T ss_pred CCCCHHHHHHHHHHHHHHCCCCCCcEeHHHHHHHHHhcCCC-CCHHHHHHHHHHhccCCcccccHHHHHHHHHHhhcccc
Confidence 46889999999999999999999999999999999999997 99999999999999999999998744 334
Q ss_pred ChhHHHHHHHhhcCCCCCccCHHHHHHHHHHhCCCCCCHHHHHHHHHHhcCCCCcceeHHHHHHHHHh
Q 028192 143 CEPELKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFVCFEDFSRMMEL 210 (212)
Q Consensus 143 ~~~~l~~~F~~~D~d~~G~I~~~El~~~l~~~g~~~ls~~~~~~l~~~~d~~~dg~I~~~eF~~~l~~ 210 (212)
..+.+..+|+.||.+++|+|+.+||+.+|..+|. .++++++..|+..+| |++|+|+|+||+++|.+
T Consensus 81 ~~~~~~~aF~~~D~d~~G~I~~~el~~~l~~~g~-~~~~~~~~~~~~~~d-d~dG~I~~~eF~~~m~k 146 (146)
T d1lkja_ 81 SEQELLEAFKVFDKNGDGLISAAELKHVLTSIGE-KLTDAEVDDMLREVS-DGSGEINIQQFAALLSK 146 (146)
T ss_dssp HHHHHHHHHHHHCSSSSCEEEHHHHHHHHHHHTC-SCCHHHHHHHHHHHC-CSSSEEEHHHHHHHHCC
T ss_pred HHHHHHHHHHHhCCCCCCcCcHHHHHHHHHHcCC-cccHHHHHHHHHhcc-CCCCeEeHHHHHHHhCC
Confidence 4678999999999999999999999999999996 899999999999999 99999999999999853
|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|