Citrus Sinensis ID: 028201


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MNIFSKKPNPKEALRESKREMQHATRGMEKEIGALQQEEKKLVAEIKRTAKTGNEGATKILARQLIRLRQQIANLQGSRAQIRGIATHTQAMHAHSSVAVGMKGASKAMAAMNKQMEPAKQAKVMREFQKQSAQMDMTTEMMSDTIDDALDNDEAEEETEELTNQVLDEIGVDVASQLSAAPKGKIASKNTEDASSSGIDELEKRLAALRNP
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHcccccccccccccccccccccHHHHHHHHHHHccc
******KPNPKE**RE****************************************ATKILARQLIRLRQQIANLQGSRAQIRGIATHTQAMHA********KGASKAMAAM**************************************DNDEAEEETEELTNQVLDEIGV*********************************LAALR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIFSKKPNPKEALRESxxxxxxxxxxxxxxxxxxxxxEKKLVAEIKRTAKTGNEGATKILARQLIRLRQQIANLQGSRAQIRGIATHTQAMHAHSSVAVGMKGASKAMAAMNKQMEPAKQAKVMREFQKQSAQMDMTTEMMSDTIDDALDNDEAEEETEELTNQVLDEIGVDVASQLSAAPKGKIASKNTEDASSSGIDELEKRLAALRNP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 2 homolog 3 Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo.confidentQ941D5
DOA4-independent degradation protein 4 Required for the sorting and concentration of proteins resulting in the entry of these proteins into the invaginating vesicles of the multivesicular body (MVB). Acts a component of the ESCRT-III complex, which appears to be critical for late steps in MVB sorting, such as membrane invagination and final cargo sorting and recruitment of late-acting components of the sorting machinery. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complex assemblies. Can directly stimulate VPS4 ATPase activity. The DID4/VPS2-VPS24 subcomplex is required for the VPS4-dependent dissociation of ESCRT-III.probableP36108
Charged multivesicular body protein 2b Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids.probableQ6NXD2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FRT, chain A
Confidence level:very confident
Coverage over the Query: 10-140
View the alignment between query and template
View the model in PyMOL