Citrus Sinensis ID: 028224

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MPPIDGSNPYVAHTPAPPSNSFSFKDAVGSVKDVLGRWGKKVGEATKKAEDLAGNTWQHLKTSPSFADAAMGRIAQGTKVLAEGGYEKIFRQTFETVPEEQLQNSYACYLSTSAGPVMGILYVSTAKLAFCSDNPLSYKSSGQTEWSYYKVVIPLHQLRAVNPSSSRNNPAEKYVQVISIDNHEFWFMGFLNYNGAVEWLQGALEARNLESV
cccccccccEEEccccccccccccccccccHHHHHHccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHcccccEEHHHHccccccHHHcccccEEECccccccEEEEEEEEcEEEEEccccccccccccEEEEEEEEEEEcccccccccccccccccccEEEEEEEcccEEEEEEHHcHHHHHHHHHHHHHHHccccc
***************************VGSVKDVLGRWGKKVGE******DLAGNTWQHLKTSPSFADAAMGRIAQGTKVLAEGGYEKIFRQTFETVPEEQLQNSYACYLSTSAGPVMGILYVSTAKLAFCSDNPLSYKSSGQTEWSYYKVVIPLHQLRAV***********KYVQVISIDNHEFWFMGFLNYNGAVEWLQGAL********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPIDGSNPYVAHTPAPPSNSFSFKDAVGSVKDVLGRWGKKVGEATKKAEDLAGNTWQHLKTSPSFADAAMGRIAQGTKVLAEGGYEKIFRQTFETVPEEQLQNSYACYLSTSAGPVMGILYVSTAKLAFCSDNPLSYKSSGQTEWSYYKVVIPLHQLRAVNPSSSRNNPAEKYVQVISIDNHEFWFMGFLNYNGAVEWLQGALEARNLESV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GLABRA2 expression modulator Involved in the spatial control of cell division, patterning and differentiation of Arabidopsis root epidermal cells. Could be part of a complex that negatively modulates GLABRA2 and CAPRICE expression via the maintenance of a repressor histone H3 epigenetics status of the GL2 and CPC promoters.probableQ8S8F8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZSQ, chain A
Confidence level:probable
Coverage over the Query: 94-206
View the alignment between query and template
View the model in PyMOL
Template: 1LW3, chain A
Confidence level:probable
Coverage over the Query: 92-205
View the alignment between query and template
View the model in PyMOL