Citrus Sinensis ID: 028239

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGSIVNLGLWDTAGQEDYSRLRPLSYRGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLREDRGYLADHVGSNVITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQPPRRKEMMARKKRHRRSSCSIARSIVCGGCAA
cccccEEEEEEEcccccccEEEHHHHcccccccccccccccccEEEEEEccEEEEEEcEEcccccccccccccccccccEEEEEEEcccccHHHHHccccHHHHHHccccccEEEEEEcccccccHHHHHHHcccccccHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHccccHHHHHHHHHccccccccCCccccccccccc
****KFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGSIVNLGLWDTAGQEDYSRLRPLSYRGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLREDRGYLADHVGSNVITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVL***********************RSIVCGGCAA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGSIVNLGLWDTAGQEDYSRLRPLSYRGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKLDLREDRGYLADHVGSNVITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQPPRRKEMMARKKRHRRSSCSIARSIVCGGCAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rac-like GTP-binding protein ARAC7 Acts as a negative regulator of abscisic acid (ABA) responses.confidentO82480
Rac-like GTP-binding protein 2 Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.confidentQ68Y52
Rho-related protein rac1A Overexpression promotes the formation of filopodia and membrane ruffles.probableP34144

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J0V, chain A
Confidence level:very confident
Coverage over the Query: 1-179
View the alignment between query and template
View the model in PyMOL