Citrus Sinensis ID: 028297


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MDSEETRGYRAFLKQSVWCLTSQYQVSFSFFFLFFCFVFSSWSFFFFQIWWAAGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGIEARGFVFGPSIALAIGAKFVPLRKPNKLPGEVISEAYVLEYGTDRLEMHVGAIEPGERALVIDDLVATGGTLSAAVRLLERMGAEVVECACVVGLPEGQRRLDGKPLYILVEPRLSVNY
cccccHHHHHHHHHHHHHHHHHcEEEEEccHHHHHHHHHHHHccccccccccccccEEccccccccHHHHHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHcccEEEcccccccccccccEEEEEccccEEEEEEccccccccEEEEEEccccccHHHHHHHHHHHHcccEEEEEEEEEEccccccccccccEEEEEcccccccc
******R*YRAFLKQSVWCLTSQYQVSFSFFFLFFCFVFSSWSFFFFQIWWAAGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGIEARGFVFGPSIALAIGAKFVPLRKPNKLPGEVISEAYVLEYGTDRLEMHVGAIEPGERALVIDDLVATGGTLSAAVRLLERMGAEVVECACVVGLPEGQRRLDGKPLYILVEPRLS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSEETRGYRAFLKQSVWCLTSQYQVSFSFFFLFFCFVFSSWSFFFFQIWWAAGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGIEARGFVFGPSIALAIGAKFVPLRKPNKLPGEVISEAYVLEYGTDRLEMHVGAIEPGERALVIDDLVATGGTLSAAVRLLERMGAEVVECACVVGLPEGQRRLDGKPLYILVEPRLSVNY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenine phosphoribosyltransferase Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.probableA7MJV7
Adenine phosphoribosyltransferase Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.probableA7FL92
Adenine phosphoribosyltransferase Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.probableB7MQI4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.2.-Pentosyltransferases.probable
2.4.2.7Adenine phosphoribosyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DY0, chain A
Confidence level:very confident
Coverage over the Query: 43-207
View the alignment between query and template
View the model in PyMOL
Template: 1U9Y, chain A
Confidence level:very confident
Coverage over the Query: 3-115,138-207
View the alignment between query and template
View the model in PyMOL