Citrus Sinensis ID: 028297
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| 225442922 | 192 | PREDICTED: adenine phosphoribosyltransfe | 0.725 | 0.796 | 0.903 | 3e-75 | |
| 297743475 | 186 | unnamed protein product [Vitis vinifera] | 0.725 | 0.822 | 0.903 | 4e-75 | |
| 255548878 | 213 | Adenine phosphoribosyltransferase, putat | 0.744 | 0.737 | 0.867 | 3e-73 | |
| 224141909 | 191 | predicted protein [Populus trichocarpa] | 0.725 | 0.801 | 0.890 | 5e-72 | |
| 449441900 | 191 | PREDICTED: adenine phosphoribosyltransfe | 0.725 | 0.801 | 0.883 | 2e-70 | |
| 224089276 | 191 | predicted protein [Populus trichocarpa] | 0.725 | 0.801 | 0.851 | 2e-70 | |
| 255553231 | 186 | Adenine phosphoribosyltransferase, putat | 0.725 | 0.822 | 0.864 | 4e-70 | |
| 225430318 | 191 | PREDICTED: adenine phosphoribosyltransfe | 0.791 | 0.874 | 0.798 | 9e-70 | |
| 351721348 | 198 | uncharacterized protein LOC100499904 [Gl | 0.725 | 0.772 | 0.845 | 1e-68 | |
| 15238973 | 191 | adenine phosphoribosyltransferase 5 [Ara | 0.720 | 0.795 | 0.818 | 1e-67 |
| >gi|225442922|ref|XP_002265016.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 286 bits (733), Expect = 3e-75, Method: Compositional matrix adjust.
Identities = 140/155 (90%), Positives = 150/155 (96%), Gaps = 2/155 (1%)
Query: 54 GIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGIEARGFVFGPSIALAIGAKFVP 113
GIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAG+EARGF+FGPSIALAIGAKFVP
Sbjct: 37 GIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGVEARGFMFGPSIALAIGAKFVP 96
Query: 114 LRKPNKLPGEVISEAYVLEYGTDRLEMHVGAIEPGERALVIDDLVATGGTLSAAVRLLER 173
LRKP KLPGEVISEAYVLEYGTDRLEMHVGA++PGERALVIDDL+ATGGTL AA++LLER
Sbjct: 97 LRKPKKLPGEVISEAYVLEYGTDRLEMHVGAVQPGERALVIDDLIATGGTLCAAIKLLER 156
Query: 174 MGAEVVECACVVGLPE--GQRRLDGKPLYILVEPR 206
+GAEVVECACV+GLPE GQ RL+GKPLYILVEPR
Sbjct: 157 VGAEVVECACVIGLPEAKGQCRLNGKPLYILVEPR 191
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297743475|emb|CBI36342.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255548878|ref|XP_002515495.1| Adenine phosphoribosyltransferase, putative [Ricinus communis] gi|223545439|gb|EEF46944.1| Adenine phosphoribosyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224141909|ref|XP_002324303.1| predicted protein [Populus trichocarpa] gi|222865737|gb|EEF02868.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449441900|ref|XP_004138720.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Cucumis sativus] gi|449527059|ref|XP_004170530.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224089276|ref|XP_002308672.1| predicted protein [Populus trichocarpa] gi|222854648|gb|EEE92195.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255553231|ref|XP_002517658.1| Adenine phosphoribosyltransferase, putative [Ricinus communis] gi|223543290|gb|EEF44822.1| Adenine phosphoribosyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225430318|ref|XP_002285191.1| PREDICTED: adenine phosphoribosyltransferase 2 [Vitis vinifera] gi|296082053|emb|CBI21058.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351721348|ref|NP_001237718.1| uncharacterized protein LOC100499904 [Glycine max] gi|255627539|gb|ACU14114.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15238973|ref|NP_196677.1| adenine phosphoribosyltransferase 5 [Arabidopsis thaliana] gi|297807153|ref|XP_002871460.1| hypothetical protein ARALYDRAFT_487948 [Arabidopsis lyrata subsp. lyrata] gi|8953378|emb|CAB96651.1| adenine phosphoribosyltransferase-like protein [Arabidopsis thaliana] gi|28393271|gb|AAO42064.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana] gi|28827532|gb|AAO50610.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana] gi|297317297|gb|EFH47719.1| hypothetical protein ARALYDRAFT_487948 [Arabidopsis lyrata subsp. lyrata] gi|332004257|gb|AED91640.1| adenine phosphoribosyltransferase 5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| TAIR|locus:2147967 | 191 | APT5 "adenine phosphoribosyltr | 0.720 | 0.795 | 0.818 | 3.7e-64 | |
| TAIR|locus:2135550 | 182 | APT4 "adenine phosphoribosyl t | 0.725 | 0.840 | 0.761 | 6.4e-60 | |
| TAIR|locus:2127480 | 183 | APT3 "adenine phosphoribosyl t | 0.725 | 0.836 | 0.774 | 6.4e-60 | |
| TAIR|locus:2016309 | 192 | APT2 "adenine phosphoribosyl t | 0.720 | 0.791 | 0.772 | 2.8e-57 | |
| UNIPROTKB|P69503 | 183 | apt "adenine phosphoribosyltra | 0.710 | 0.819 | 0.532 | 1.1e-39 | |
| UNIPROTKB|Q9KT52 | 181 | apt "Adenine phosphoribosyltra | 0.701 | 0.817 | 0.506 | 1.8e-39 | |
| TIGR_CMR|VC_1053 | 181 | VC_1053 "adenine phosphoribosy | 0.701 | 0.817 | 0.506 | 1.8e-39 | |
| TIGR_CMR|SO_2012 | 181 | SO_2012 "adenine phosphoribosy | 0.668 | 0.779 | 0.496 | 6.5e-35 | |
| TIGR_CMR|CPS_3745 | 181 | CPS_3745 "adenine phosphoribos | 0.668 | 0.779 | 0.482 | 2e-33 | |
| TIGR_CMR|SPO_3066 | 179 | SPO_3066 "adenine phosphoribos | 0.668 | 0.787 | 0.471 | 2.3e-32 |
| TAIR|locus:2147967 APT5 "adenine phosphoribosyltransferase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 654 (235.3 bits), Expect = 3.7e-64, P = 3.7e-64
Identities = 126/154 (81%), Positives = 140/154 (90%)
Query: 54 GIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGIEARGFVFGPSIALAIGAKFVP 113
GIMFQDITTLLLDHKAFK T+DIFVDRY+DM ISVVAG+EARGF+FGPSIALAIGAKF+P
Sbjct: 31 GIMFQDITTLLLDHKAFKHTIDIFVDRYKDMQISVVAGVEARGFLFGPSIALAIGAKFIP 90
Query: 114 LRKPNKLPGEVISEAYVLEYGTDRLEMHVGAIEPGERALVIDDLVATGGTLSAAVRLLER 173
LRKP KLPG+VISE+Y LEYG DRLEMHVGA+EP ER ++IDDLVATGGTLSAA+ LLE
Sbjct: 91 LRKPGKLPGKVISESYELEYGHDRLEMHVGAVEPRERVIIIDDLVATGGTLSAAMSLLES 150
Query: 174 MGAEVVECACVVGLPE--GQRRLDGKPLYILVEP 205
GAEVVECACV+GLPE GQ +L GKPLY+LVEP
Sbjct: 151 QGAEVVECACVIGLPEVKGQHKLKGKPLYVLVEP 184
|
|
| TAIR|locus:2135550 APT4 "adenine phosphoribosyl transferase 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127480 APT3 "adenine phosphoribosyl transferase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2016309 APT2 "adenine phosphoribosyl transferase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P69503 apt "adenine phosphoribosyltransferase" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KT52 apt "Adenine phosphoribosyltransferase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1053 VC_1053 "adenine phosphoribosyltransferase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_2012 SO_2012 "adenine phosphoribosyltransferase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_3745 CPS_3745 "adenine phosphoribosyltransferase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_3066 SPO_3066 "adenine phosphoribosyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| PLN02293 | 187 | PLN02293, PLN02293, adenine phosphoribosyltransfer | 1e-110 | |
| PRK02304 | 175 | PRK02304, PRK02304, adenine phosphoribosyltransfer | 2e-77 | |
| TIGR01090 | 169 | TIGR01090, apt, adenine phosphoribosyltransferase | 2e-63 | |
| COG0503 | 179 | COG0503, Apt, Adenine/guanine phosphoribosyltransf | 2e-55 | |
| cd06223 | 130 | cd06223, PRTases_typeI, Phosphoribosyl transferase | 3e-28 | |
| PRK12560 | 187 | PRK12560, PRK12560, adenine phosphoribosyltransfer | 8e-27 | |
| pfam00156 | 123 | pfam00156, Pribosyltran, Phosphoribosyl transferas | 4e-24 | |
| PRK00455 | 202 | PRK00455, pyrE, orotate phosphoribosyltransferase; | 2e-09 | |
| COG0461 | 201 | COG0461, PyrE, Orotate phosphoribosyltransferase [ | 3e-09 | |
| PRK09213 | 271 | PRK09213, PRK09213, pur operon repressor; Provisio | 3e-07 | |
| TIGR01367 | 187 | TIGR01367, pyrE_Therm, orotate phosphoribosyltrans | 3e-07 | |
| TIGR01743 | 268 | TIGR01743, purR_Bsub, pur operon repressor, Bacill | 4e-07 | |
| PRK13810 | 187 | PRK13810, PRK13810, orotate phosphoribosyltransfer | 5e-07 | |
| PRK06031 | 233 | PRK06031, PRK06031, phosphoribosyltransferase; Pro | 6e-07 | |
| PRK09219 | 189 | PRK09219, PRK09219, xanthine phosphoribosyltransfe | 9e-07 | |
| PRK00129 | 209 | PRK00129, upp, uracil phosphoribosyltransferase; R | 1e-06 | |
| PRK07322 | 178 | PRK07322, PRK07322, adenine phosphoribosyltransfer | 1e-06 | |
| TIGR01251 | 308 | TIGR01251, ribP_PPkin, ribose-phosphate pyrophosph | 1e-06 | |
| COG0462 | 314 | COG0462, PrsA, Phosphoribosylpyrophosphate synthet | 2e-06 | |
| PRK08558 | 238 | PRK08558, PRK08558, adenine phosphoribosyltransfer | 3e-06 | |
| PRK00934 | 285 | PRK00934, PRK00934, ribose-phosphate pyrophosphoki | 6e-06 | |
| TIGR00336 | 173 | TIGR00336, pyrE, orotate phosphoribosyltransferase | 1e-05 | |
| COG0035 | 210 | COG0035, Upp, Uracil phosphoribosyltransferase [Nu | 7e-05 | |
| PRK02277 | 200 | PRK02277, PRK02277, orotate phosphoribosyltransfer | 1e-04 | |
| TIGR01091 | 207 | TIGR01091, upp, uracil phosphoribosyltransferase | 1e-04 | |
| TIGR01744 | 191 | TIGR01744, XPRTase, xanthine phosphoribosyltransfe | 1e-04 | |
| PRK13812 | 176 | PRK13812, PRK13812, orotate phosphoribosyltransfer | 2e-04 | |
| COG1040 | 225 | COG1040, ComFC, Predicted amidophosphoribosyltrans | 3e-04 | |
| PRK02812 | 330 | PRK02812, PRK02812, ribose-phosphate pyrophosphoki | 4e-04 | |
| PRK06827 | 382 | PRK06827, PRK06827, phosphoribosylpyrophosphate sy | 6e-04 | |
| COG0856 | 203 | COG0856, COG0856, Orotate phosphoribosyltransferas | 6e-04 | |
| PRK07199 | 301 | PRK07199, PRK07199, phosphoribosylpyrophosphate sy | 8e-04 | |
| PRK03092 | 304 | PRK03092, PRK03092, ribose-phosphate pyrophosphoki | 0.001 | |
| PLN02541 | 244 | PLN02541, PLN02541, uracil phosphoribosyltransfera | 0.002 | |
| PLN02369 | 302 | PLN02369, PLN02369, ribose-phosphate pyrophosphoki | 0.004 |
| >gnl|CDD|177930 PLN02293, PLN02293, adenine phosphoribosyltransferase | Back alignment and domain information |
|---|
Score = 312 bits (802), Expect = e-110
Identities = 129/155 (83%), Positives = 142/155 (91%), Gaps = 2/155 (1%)
Query: 54 GIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGIEARGFVFGPSIALAIGAKFVP 113
GIMFQDITTLLLD KAFKDT+D+FV+RYRDMGISVVAGIEARGF+FGP IALAIGAKFVP
Sbjct: 31 GIMFQDITTLLLDPKAFKDTIDLFVERYRDMGISVVAGIEARGFIFGPPIALAIGAKFVP 90
Query: 114 LRKPNKLPGEVISEAYVLEYGTDRLEMHVGAIEPGERALVIDDLVATGGTLSAAVRLLER 173
LRKP KLPGEVISE YVLEYGTD LEMHVGA+EPGERALVIDDL+ATGGTL AA+ LLER
Sbjct: 91 LRKPGKLPGEVISEEYVLEYGTDCLEMHVGAVEPGERALVIDDLIATGGTLCAAINLLER 150
Query: 174 MGAEVVECACVVGLPE--GQRRLDGKPLYILVEPR 206
GAEVVECACV+ LPE G+ +L+GKPL++LVE R
Sbjct: 151 AGAEVVECACVIELPELKGREKLNGKPLFVLVESR 185
|
Length = 187 |
| >gnl|CDD|235028 PRK02304, PRK02304, adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233267 TIGR01090, apt, adenine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223577 COG0503, Apt, Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|206754 cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain | Back alignment and domain information |
|---|
| >gnl|CDD|183595 PRK12560, PRK12560, adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215757 pfam00156, Pribosyltran, Phosphoribosyl transferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|234771 PRK00455, pyrE, orotate phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223537 COG0461, PyrE, Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236414 PRK09213, PRK09213, pur operon repressor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233377 TIGR01367, pyrE_Therm, orotate phosphoribosyltransferase, Thermus family | Back alignment and domain information |
|---|
| >gnl|CDD|130804 TIGR01743, purR_Bsub, pur operon repressor, Bacillus subtilis type | Back alignment and domain information |
|---|
| >gnl|CDD|184341 PRK13810, PRK13810, orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235678 PRK06031, PRK06031, phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181705 PRK09219, PRK09219, xanthine phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234653 PRK00129, upp, uracil phosphoribosyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180928 PRK07322, PRK07322, adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130318 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >gnl|CDD|223538 COG0462, PrsA, Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181466 PRK08558, PRK08558, adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234868 PRK00934, PRK00934, ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129436 TIGR00336, pyrE, orotate phosphoribosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223113 COG0035, Upp, Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235023 PRK02277, PRK02277, orotate phosphoribosyltransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130163 TIGR01091, upp, uracil phosphoribosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|130805 TIGR01744, XPRTase, xanthine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237519 PRK13812, PRK13812, orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223970 COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235072 PRK02812, PRK02812, ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180714 PRK06827, PRK06827, phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223925 COG0856, COG0856, Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235960 PRK07199, PRK07199, phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179535 PRK03092, PRK03092, ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215297 PLN02541, PLN02541, uracil phosphoribosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215209 PLN02369, PLN02369, ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| COG0462 | 314 | PrsA Phosphoribosylpyrophosphate synthetase [Nucle | 100.0 | |
| KOG1712 | 183 | consensus Adenine phosphoribosyl transferases [Nuc | 100.0 | |
| PLN02293 | 187 | adenine phosphoribosyltransferase | 99.97 | |
| PRK02269 | 320 | ribose-phosphate pyrophosphokinase; Provisional | 99.97 | |
| PRK07199 | 301 | phosphoribosylpyrophosphate synthetase; Provisiona | 99.97 | |
| PRK00553 | 332 | ribose-phosphate pyrophosphokinase; Provisional | 99.97 | |
| PTZ00145 | 439 | phosphoribosylpyrophosphate synthetase; Provisiona | 99.97 | |
| PRK04923 | 319 | ribose-phosphate pyrophosphokinase; Provisional | 99.97 | |
| PRK03092 | 304 | ribose-phosphate pyrophosphokinase; Provisional | 99.97 | |
| PRK02304 | 175 | adenine phosphoribosyltransferase; Provisional | 99.96 | |
| PRK02458 | 323 | ribose-phosphate pyrophosphokinase; Provisional | 99.96 | |
| PRK00934 | 285 | ribose-phosphate pyrophosphokinase; Provisional | 99.96 | |
| TIGR01090 | 169 | apt adenine phosphoribosyltransferase. A phylogene | 99.96 | |
| KOG1448 | 316 | consensus Ribose-phosphate pyrophosphokinase [Nucl | 99.96 | |
| PRK06827 | 382 | phosphoribosylpyrophosphate synthetase; Provisiona | 99.96 | |
| PRK02812 | 330 | ribose-phosphate pyrophosphokinase; Provisional | 99.96 | |
| PRK01259 | 309 | ribose-phosphate pyrophosphokinase; Provisional | 99.96 | |
| PLN02369 | 302 | ribose-phosphate pyrophosphokinase | 99.95 | |
| PLN02297 | 326 | ribose-phosphate pyrophosphokinase | 99.94 | |
| TIGR01251 | 308 | ribP_PPkin ribose-phosphate pyrophosphokinase. In | 99.94 | |
| PRK13810 | 187 | orotate phosphoribosyltransferase; Provisional | 99.94 | |
| COG0503 | 179 | Apt Adenine/guanine phosphoribosyltransferases and | 99.94 | |
| PRK13809 | 206 | orotate phosphoribosyltransferase; Provisional | 99.94 | |
| PRK09219 | 189 | xanthine phosphoribosyltransferase; Validated | 99.93 | |
| TIGR01744 | 191 | XPRTase xanthine phosphoribosyltransferase. This m | 99.93 | |
| PRK12560 | 187 | adenine phosphoribosyltransferase; Provisional | 99.93 | |
| PRK13812 | 176 | orotate phosphoribosyltransferase; Provisional | 99.92 | |
| TIGR01743 | 268 | purR_Bsub pur operon repressor, Bacillus subtilis | 99.92 | |
| PRK09213 | 271 | pur operon repressor; Provisional | 99.92 | |
| PRK13811 | 170 | orotate phosphoribosyltransferase; Provisional | 99.91 | |
| PRK05500 | 477 | bifunctional orotidine 5'-phosphate decarboxylase/ | 99.91 | |
| PRK08558 | 238 | adenine phosphoribosyltransferase; Provisional | 99.91 | |
| PRK02277 | 200 | orotate phosphoribosyltransferase-like protein; Pr | 99.9 | |
| PRK00455 | 202 | pyrE orotate phosphoribosyltransferase; Validated | 99.9 | |
| TIGR00336 | 173 | pyrE orotate phosphoribosyltransferase. The conser | 99.9 | |
| TIGR01367 | 187 | pyrE_Therm orotate phosphoribosyltransferase, Ther | 99.9 | |
| COG0461 | 201 | PyrE Orotate phosphoribosyltransferase [Nucleotide | 99.9 | |
| PRK07322 | 178 | adenine phosphoribosyltransferase; Provisional | 99.88 | |
| PRK06031 | 233 | phosphoribosyltransferase; Provisional | 99.82 | |
| PF00156 | 125 | Pribosyltran: Phosphoribosyl transferase domain; I | 99.82 | |
| COG0856 | 203 | Orotate phosphoribosyltransferase homologs [Nucleo | 99.8 | |
| COG1040 | 225 | ComFC Predicted amidophosphoribosyltransferases [G | 99.74 | |
| KOG1503 | 354 | consensus Phosphoribosylpyrophosphate synthetase-a | 99.73 | |
| TIGR00201 | 190 | comF comF family protein. This protein is found in | 99.72 | |
| PRK09162 | 181 | hypoxanthine-guanine phosphoribosyltransferase; Pr | 99.71 | |
| PRK08525 | 445 | amidophosphoribosyltransferase; Provisional | 99.7 | |
| TIGR01203 | 166 | HGPRTase hypoxanthine phosphoribosyltransferase. S | 99.7 | |
| PF14572 | 184 | Pribosyl_synth: Phosphoribosyl synthetase-associat | 99.69 | |
| PRK11595 | 227 | DNA utilization protein GntX; Provisional | 99.68 | |
| PLN02238 | 189 | hypoxanthine phosphoribosyltransferase | 99.67 | |
| PRK15423 | 178 | hypoxanthine phosphoribosyltransferase; Provisiona | 99.62 | |
| PRK09177 | 156 | xanthine-guanine phosphoribosyltransferase; Valida | 99.61 | |
| PRK05793 | 469 | amidophosphoribosyltransferase; Provisional | 99.59 | |
| PRK09246 | 501 | amidophosphoribosyltransferase; Provisional | 99.58 | |
| PRK05205 | 176 | bifunctional pyrimidine regulatory protein PyrR ur | 99.58 | |
| TIGR01134 | 442 | purF amidophosphoribosyltransferase. Alternate nam | 99.57 | |
| PRK07272 | 484 | amidophosphoribosyltransferase; Provisional | 99.57 | |
| PTZ00271 | 211 | hypoxanthine-guanine phosphoribosyltransferase; Pr | 99.55 | |
| PLN02440 | 479 | amidophosphoribosyltransferase | 99.54 | |
| PRK06781 | 471 | amidophosphoribosyltransferase; Provisional | 99.53 | |
| PRK07349 | 500 | amidophosphoribosyltransferase; Provisional | 99.52 | |
| COG0634 | 178 | Hpt Hypoxanthine-guanine phosphoribosyltransferase | 99.5 | |
| PRK08341 | 442 | amidophosphoribosyltransferase; Provisional | 99.5 | |
| PRK09123 | 479 | amidophosphoribosyltransferase; Provisional | 99.49 | |
| PTZ00149 | 241 | hypoxanthine phosphoribosyltransferase; Provisiona | 99.48 | |
| COG2236 | 192 | Predicted phosphoribosyltransferases [General func | 99.48 | |
| PRK07631 | 475 | amidophosphoribosyltransferase; Provisional | 99.48 | |
| PRK06388 | 474 | amidophosphoribosyltransferase; Provisional | 99.47 | |
| PRK07847 | 510 | amidophosphoribosyltransferase; Provisional | 99.45 | |
| PRK00129 | 209 | upp uracil phosphoribosyltransferase; Reviewed | 99.33 | |
| COG0034 | 470 | PurF Glutamine phosphoribosylpyrophosphate amidotr | 99.3 | |
| TIGR01091 | 207 | upp uracil phosphoribosyltransferase. that include | 99.28 | |
| COG2065 | 179 | PyrR Pyrimidine operon attenuation protein/uracil | 99.13 | |
| COG1926 | 220 | Predicted phosphoribosyltransferases [General func | 99.13 | |
| PF13793 | 116 | Pribosyltran_N: N-terminal domain of ribose phosph | 99.05 | |
| KOG0572 | 474 | consensus Glutamine phosphoribosylpyrophosphate am | 98.96 | |
| KOG3367 | 216 | consensus Hypoxanthine-guanine phosphoribosyltrans | 98.81 | |
| PLN02541 | 244 | uracil phosphoribosyltransferase | 98.53 | |
| COG0035 | 210 | Upp Uracil phosphoribosyltransferase [Nucleotide t | 98.46 | |
| PF14681 | 207 | UPRTase: Uracil phosphoribosyltransferase; PDB: 1V | 98.36 | |
| PF15609 | 191 | PRTase_2: Phosphoribosyl transferase | 98.17 | |
| PF15610 | 274 | PRTase_3: PRTase ComF-like | 96.75 | |
| KOG1017 | 267 | consensus Predicted uracil phosphoribosyltransfera | 95.68 | |
| PF13793 | 116 | Pribosyltran_N: N-terminal domain of ribose phosph | 93.65 | |
| PRK02812 | 330 | ribose-phosphate pyrophosphokinase; Provisional | 91.0 | |
| PTZ00145 | 439 | phosphoribosylpyrophosphate synthetase; Provisiona | 90.29 | |
| KOG1377 | 261 | consensus Uridine 5'- monophosphate synthase/orota | 89.97 | |
| PRK07199 | 301 | phosphoribosylpyrophosphate synthetase; Provisiona | 88.89 | |
| PRK03092 | 304 | ribose-phosphate pyrophosphokinase; Provisional | 88.88 | |
| PLN02369 | 302 | ribose-phosphate pyrophosphokinase | 88.86 | |
| PRK00934 | 285 | ribose-phosphate pyrophosphokinase; Provisional | 88.74 | |
| PRK01259 | 309 | ribose-phosphate pyrophosphokinase; Provisional | 88.63 | |
| PRK00553 | 332 | ribose-phosphate pyrophosphokinase; Provisional | 88.58 | |
| PRK02269 | 320 | ribose-phosphate pyrophosphokinase; Provisional | 88.53 | |
| PRK04923 | 319 | ribose-phosphate pyrophosphokinase; Provisional | 87.45 | |
| COG0462 | 314 | PrsA Phosphoribosylpyrophosphate synthetase [Nucle | 87.1 | |
| TIGR01251 | 308 | ribP_PPkin ribose-phosphate pyrophosphokinase. In | 86.09 | |
| PRK02458 | 323 | ribose-phosphate pyrophosphokinase; Provisional | 83.58 |
| >COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.9e-38 Score=267.65 Aligned_cols=187 Identities=22% Similarity=0.264 Sum_probs=154.9
Q ss_pred cccccceeeEEEeeecccCcccceeeeeeeeee---------------eeeecceeeeeecCCCCCCeeheeHHHHhcCH
Q 028297 3 SEETRGYRAFLKQSVWCLTSQYQVSFSFFFLFF---------------CFVFSSWSFFFFQIWWAAGIMFQDITTLLLDH 67 (211)
Q Consensus 3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------------~~~~~~~~~~~~~~~~~~~i~~~d~~~l~~~~ 67 (211)
.|||||+||||+||+++| +|+|+||++. ++||++|+||+....+++||+.+.+++++...
T Consensus 46 ~EsVrg~dVfI~qs~~~p-----vnd~lmELLi~idA~k~asA~~It~ViPY~gYARQDk~~~~repIsaklvA~lL~~a 120 (314)
T COG0462 46 EESVRGKDVFIIQSTSPP-----VNDNLMELLIMIDALKRASAKRITAVIPYFGYARQDKAFKPREPISAKLVANLLETA 120 (314)
T ss_pred cccccCCeEEEEeCCCCC-----cCHHHHHHHHHHHHHHhcCCceEEEEeecchhhccCcccCCCCCEeHHHHHHHHHHc
Confidence 599999999999999976 9999999843 79999999999655899999999999999877
Q ss_pred HHHH-HHHHHHHHHHhh---------------------c-C--CcEEEEecCCccchHHHHHHHhCCCeEEeecCCC-CC
Q 028297 68 KAFK-DTVDIFVDRYRD---------------------M-G--ISVVAGIEARGFVFGPSIALAIGAKFVPLRKPNK-LP 121 (211)
Q Consensus 68 ~~~~-~~~~~la~~i~~---------------------~-~--~d~Iv~i~~gG~~~A~~lA~~L~~p~~~~~k~~~-~~ 121 (211)
+..+ .+.+.|+.++++ . . -.+||+|+.||..+|+.+|+.||.|+.++.|+|. .+
T Consensus 121 G~drv~TvDlH~~qiqgfFdipvdnl~a~p~l~~~~~~~~~~~d~vVVSPD~Ggv~RAr~~A~~L~~~~a~i~K~R~~~~ 200 (314)
T COG0462 121 GADRVLTVDLHAPQIQGFFDIPVDNLYAAPLLAEYIREKYDLDDPVVVSPDKGGVKRARALADRLGAPLAIIDKRRDSSP 200 (314)
T ss_pred CCCeEEEEcCCchhhcccCCCccccccchHHHHHHHHHhcCCCCcEEECCCccHHHHHHHHHHHhCCCEEEEEEeecCCC
Confidence 6666 666666666442 2 1 2499999999999999999999999999998884 33
Q ss_pred CceeeeeeeeecCceeEEEecCCcCCCCEEEEEeccccchHHHHHHHHHHHhCCCeEEEEEEEEeCch--hhcccCCCCe
Q 028297 122 GEVISEAYVLEYGTDRLEMHVGAIEPGERALVIDDLVATGGTLSAAVRLLERMGAEVVECACVVGLPE--GQRRLDGKPL 199 (211)
Q Consensus 122 ~~~~~~~~~~~~~~~~~~~~~~~~~~gk~VLIVDDiitTG~Tl~~a~~~L~~~Ga~~V~v~~~~~~~~--~~~~l~~~~l 199 (211)
+.. .+....+++ +||+|+|||||++||+|+..|+++|++.||++|+++|+|+.++ +.+++++..+
T Consensus 201 ~~v------------~~~~~~gdV-~gk~~iiVDDiIdTgGTi~~Aa~~Lk~~GAk~V~a~~tH~vfs~~a~~~l~~~~i 267 (314)
T COG0462 201 NVV------------EVMNLIGDV-EGKDVVIVDDIIDTGGTIAKAAKALKERGAKKVYAAATHGVFSGAALERLEASAI 267 (314)
T ss_pred CeE------------EEeeccccc-CCCEEEEEeccccccHHHHHHHHHHHHCCCCeEEEEEEchhhChHHHHHHhcCCC
Confidence 322 111123554 9999999999999999999999999999999999999999998 7788887677
Q ss_pred EEEEcccc
Q 028297 200 YILVEPRL 207 (211)
Q Consensus 200 ~sl~~~~~ 207 (211)
..++.-+.
T Consensus 268 ~~vivTnT 275 (314)
T COG0462 268 DEVIVTDT 275 (314)
T ss_pred CEEEEeCC
Confidence 77765443
|
|
| >KOG1712 consensus Adenine phosphoribosyl transferases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02293 adenine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK02269 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK07199 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00553 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK04923 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK03092 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK02304 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02458 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK00934 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01090 apt adenine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >KOG1448 consensus Ribose-phosphate pyrophosphokinase [Nucleotide transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06827 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK02812 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK01259 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02369 ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >PLN02297 ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >PRK13810 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13809 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09219 xanthine phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01744 XPRTase xanthine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK12560 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13812 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01743 purR_Bsub pur operon repressor, Bacillus subtilis type | Back alignment and domain information |
|---|
| >PRK09213 pur operon repressor; Provisional | Back alignment and domain information |
|---|
| >PRK13811 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated | Back alignment and domain information |
|---|
| >PRK08558 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02277 orotate phosphoribosyltransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK00455 pyrE orotate phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00336 pyrE orotate phosphoribosyltransferase | Back alignment and domain information |
|---|
| >TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family | Back alignment and domain information |
|---|
| >COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07322 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06031 phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00156 Pribosyltran: Phosphoribosyl transferase domain; InterPro: IPR000836 The name PRT comes from phosphoribosyltransferase (PRTase) enzymes, which carry out phosphoryl transfer reactions on 5-phosphoribosyl-alpha1-pyrophosphate PRPP, an activated form of ribose-5-phosphate | Back alignment and domain information |
|---|
| >COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1503 consensus Phosphoribosylpyrophosphate synthetase-associated protein [Amino acid transport and metabolism; Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00201 comF comF family protein | Back alignment and domain information |
|---|
| >PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08525 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PF14572 Pribosyl_synth: Phosphoribosyl synthetase-associated domain; PDB: 2H07_B 2H06_B 3S5J_B 2HCR_A 3EFH_A 2H08_A 1DKR_B 1DKU_B 1IBS_B 2JI4_A | Back alignment and domain information |
|---|
| >PRK11595 DNA utilization protein GntX; Provisional | Back alignment and domain information |
|---|
| >PLN02238 hypoxanthine phosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK15423 hypoxanthine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09177 xanthine-guanine phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK05793 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09246 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01134 purF amidophosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK07272 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02440 amidophosphoribosyltransferase | Back alignment and domain information |
|---|
| >PRK06781 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07349 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08341 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09123 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2236 Predicted phosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07631 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06388 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07847 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00129 upp uracil phosphoribosyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01091 upp uracil phosphoribosyltransferase | Back alignment and domain information |
|---|
| >COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1926 Predicted phosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13793 Pribosyltran_N: N-terminal domain of ribose phosphate pyrophosphokinase; PDB: 2JI4_A 1DKU_B 1IBS_B 1DKR_B 3MBI_C 3LRT_B 3LPN_B 3NAG_B 2H07_B 2H06_B | Back alignment and domain information |
|---|
| >KOG0572 consensus Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3367 consensus Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02541 uracil phosphoribosyltransferase | Back alignment and domain information |
|---|
| >COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF14681 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C | Back alignment and domain information |
|---|
| >PF15609 PRTase_2: Phosphoribosyl transferase | Back alignment and domain information |
|---|
| >PF15610 PRTase_3: PRTase ComF-like | Back alignment and domain information |
|---|
| >KOG1017 consensus Predicted uracil phosphoribosyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13793 Pribosyltran_N: N-terminal domain of ribose phosphate pyrophosphokinase; PDB: 2JI4_A 1DKU_B 1IBS_B 1DKR_B 3MBI_C 3LRT_B 3LPN_B 3NAG_B 2H07_B 2H06_B | Back alignment and domain information |
|---|
| >PRK02812 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG1377 consensus Uridine 5'- monophosphate synthase/orotate phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07199 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK03092 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02369 ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >PRK00934 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK01259 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK00553 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK02269 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK04923 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase | Back alignment and domain information |
|---|
| >PRK02458 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 211 | ||||
| 2dy0_A | 190 | Crystal Structure Of Project Jw0458 From Escherichi | 2e-42 | ||
| 1ore_A | 180 | Human Adenine Phosphoribosyltransferase Length = 18 | 2e-27 | ||
| 1g2q_A | 187 | Crystal Structure Of Adenine Phosphoribosyltransfer | 3e-21 | ||
| 1mzv_A | 235 | Crystal Structure Of Adenine Phosphoribosyltransfer | 4e-18 | ||
| 1l1q_A | 186 | Crystal Structure Of Aprtase From Giardia Lamblia C | 3e-16 | ||
| 1qb7_A | 236 | Crystal Structures Of Adenine Phosphoribosyltransfe | 5e-16 | ||
| 1o57_A | 291 | Crystal Structure Of The Purine Operon Repressor Of | 4e-04 | ||
| 1p4a_A | 285 | Crystal Structure Of The Purr Complexed With Cprpp | 4e-04 | ||
| 1u9y_A | 284 | Crystal Structure Of Phosphoribosyl Diphosphate Syn | 6e-04 |
| >pdb|2DY0|A Chain A, Crystal Structure Of Project Jw0458 From Escherichia Coli Length = 190 | Back alignment and structure |
|
| >pdb|1ORE|A Chain A, Human Adenine Phosphoribosyltransferase Length = 180 | Back alignment and structure |
| >pdb|1G2Q|A Chain A, Crystal Structure Of Adenine Phosphoribosyltransferase Length = 187 | Back alignment and structure |
| >pdb|1MZV|A Chain A, Crystal Structure Of Adenine Phosphoribosyltransferase (Aprt) From Leishmania Tarentolae Length = 235 | Back alignment and structure |
| >pdb|1L1Q|A Chain A, Crystal Structure Of Aprtase From Giardia Lamblia Complexed With 9- Deazaadenine Length = 186 | Back alignment and structure |
| >pdb|1QB7|A Chain A, Crystal Structures Of Adenine Phosphoribosyltransferase From Leishmania Donovani. Length = 236 | Back alignment and structure |
| >pdb|1O57|A Chain A, Crystal Structure Of The Purine Operon Repressor Of Bacillus Subtilis Length = 291 | Back alignment and structure |
| >pdb|1P4A|A Chain A, Crystal Structure Of The Purr Complexed With Cprpp Length = 285 | Back alignment and structure |
| >pdb|1U9Y|A Chain A, Crystal Structure Of Phosphoribosyl Diphosphate Synthase From Methanocaldococcus Jannaschii Length = 284 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| 2dy0_A | 190 | APRT, adenine phosphoribosyltransferase; structura | 1e-85 | |
| 1zn8_A | 180 | APRT, adenine phosphoribosyltransferase; glycosylt | 4e-83 | |
| 1g2q_A | 187 | Adenine phosphoribosyltransferase 1; dimer, single | 7e-81 | |
| 1l1q_A | 186 | Adenine phosphoribosyltransferase; aprtase, giardi | 2e-77 | |
| 1qb7_A | 236 | APRT, adenine phosphoribosyltransferase; dinucleot | 8e-77 | |
| 1o57_A | 291 | PUR operon repressor; purine operon repressor, hel | 4e-56 | |
| 1y0b_A | 197 | Xanthine phosphoribosyltransferase; purine metabol | 1e-48 | |
| 1vch_A | 175 | Phosphoribosyltransferase-related protein; structu | 4e-33 | |
| 2p1z_A | 180 | Phosphoribosyltransferase; STRU genomics, PSI-2, p | 4e-14 | |
| 2aee_A | 211 | OPRT, oprtase, orotate phosphoribosyltransferase; | 5e-13 | |
| 2wns_A | 205 | Orotate phosphoribosyltransferase; alternative spl | 2e-12 | |
| 3m3h_A | 234 | OPRT, oprtase, orotate phosphoribosyltransferase; | 2e-12 | |
| 3dez_A | 243 | OPRT, oprtase, orotate phosphoribosyltransferase; | 2e-12 | |
| 3qw4_B | 453 | UMP synthase; N-terminal orotidine monophosphate d | 1e-11 | |
| 2yzk_A | 178 | OPRT, oprtase, orotate phosphoribosyltransferase; | 1e-10 | |
| 2ps1_A | 226 | Orotate phosphoribosyltransferase 1; alpha beta, o | 1e-08 | |
| 3mjd_A | 232 | Orotate phosphoribosyltransferase; IDP02311, csgid | 3e-07 | |
| 1lh0_A | 213 | OMP synthase; loop closure, monomer closure, orota | 2e-06 | |
| 3n2l_A | 238 | OPRT, oprtase, orotate phosphoribosyltransferase; | 6e-06 | |
| 1vdm_A | 153 | Purine phosphoribosyltransferase; structural genom | 6e-06 | |
| 1wd5_A | 208 | Hypothetical protein TT1426; structural genomics, | 7e-06 | |
| 1u9y_A | 284 | RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy | 2e-05 | |
| 1dku_A | 317 | Protein (phosphoribosyl pyrophosphate synthetase); | 3e-05 | |
| 3lrt_A | 286 | Ribose-phosphate pyrophosphokinase; phosphoribosyl | 3e-05 | |
| 2xbu_A | 221 | Hypoxanthine-guanine phosphoribosyltransferase; gl | 6e-05 | |
| 3dah_A | 319 | Ribose-phosphate pyrophosphokinase; pyrophosphoki | 7e-05 | |
| 3s5j_B | 326 | Ribose-phosphate pyrophosphokinase 1; nucleotide s | 1e-04 | |
| 2ji4_A | 379 | Phosphoribosyl pyrophosphate synthetase-associated | 3e-04 |
| >2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Length = 190 | Back alignment and structure |
|---|
Score = 250 bits (640), Expect = 1e-85
Identities = 81/155 (52%), Positives = 116/155 (74%), Gaps = 4/155 (2%)
Query: 54 GIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGIEARGFVFGPSIALAIGAKFVP 113
GI+F+D+T+LL D KA+ ++D+ V+RY++ GI+ V G EARGF+FG +AL +G FVP
Sbjct: 32 GILFRDVTSLLEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVP 91
Query: 114 LRKPNKLPGEVISEAYVLEYGTDRLEMHVGAIEPGERALVIDDLVATGGTLSAAVRLLER 173
+RKP KLP E ISE Y LEYGTD+LE+HV AI+PG++ LV+DDL+ATGGT+ A V+L+ R
Sbjct: 92 VRKPGKLPRETISETYDLEYGTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRR 151
Query: 174 MGAEVVECACVVGLPE--GQRRLDGK--PLYILVE 204
+G EV + A ++ L + G++RL+ + Y LV
Sbjct: 152 LGGEVADAAFIINLFDLGGEQRLEKQGITSYSLVP 186
|
| >1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Length = 180 | Back alignment and structure |
|---|
| >1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Length = 187 | Back alignment and structure |
|---|
| >1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Length = 186 | Back alignment and structure |
|---|
| >1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Length = 236 | Back alignment and structure |
|---|
| >1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Length = 291 | Back alignment and structure |
|---|
| >1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Length = 197 | Back alignment and structure |
|---|
| >1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Length = 175 | Back alignment and structure |
|---|
| >2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} Length = 180 | Back alignment and structure |
|---|
| >2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Length = 211 | Back alignment and structure |
|---|
| >2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Length = 205 | Back alignment and structure |
|---|
| >3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Length = 234 | Back alignment and structure |
|---|
| >3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Length = 243 | Back alignment and structure |
|---|
| >3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Length = 453 | Back alignment and structure |
|---|
| >2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Length = 178 | Back alignment and structure |
|---|
| >2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Length = 226 | Back alignment and structure |
|---|
| >3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Length = 232 | Back alignment and structure |
|---|
| >1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Length = 213 | Back alignment and structure |
|---|
| >3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Length = 238 | Back alignment and structure |
|---|
| >1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Length = 153 | Back alignment and structure |
|---|
| >1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Length = 208 | Back alignment and structure |
|---|
| >1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Length = 284 | Back alignment and structure |
|---|
| >1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Length = 317 | Back alignment and structure |
|---|
| >3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Length = 286 | Back alignment and structure |
|---|
| >2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Length = 221 | Back alignment and structure |
|---|
| >3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} Length = 319 | Back alignment and structure |
|---|
| >3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A Length = 326 | Back alignment and structure |
|---|
| >2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Length = 379 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| 3s5j_B | 326 | Ribose-phosphate pyrophosphokinase 1; nucleotide s | 100.0 | |
| 3dah_A | 319 | Ribose-phosphate pyrophosphokinase; pyrophosphoki | 100.0 | |
| 1u9y_A | 284 | RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy | 99.98 | |
| 1dku_A | 317 | Protein (phosphoribosyl pyrophosphate synthetase); | 99.98 | |
| 3lrt_A | 286 | Ribose-phosphate pyrophosphokinase; phosphoribosyl | 99.98 | |
| 2ji4_A | 379 | Phosphoribosyl pyrophosphate synthetase-associated | 99.97 | |
| 2dy0_A | 190 | APRT, adenine phosphoribosyltransferase; structura | 99.97 | |
| 1zn8_A | 180 | APRT, adenine phosphoribosyltransferase; glycosylt | 99.97 | |
| 1g2q_A | 187 | Adenine phosphoribosyltransferase 1; dimer, single | 99.97 | |
| 1qb7_A | 236 | APRT, adenine phosphoribosyltransferase; dinucleot | 99.97 | |
| 1l1q_A | 186 | Adenine phosphoribosyltransferase; aprtase, giardi | 99.96 | |
| 3m3h_A | 234 | OPRT, oprtase, orotate phosphoribosyltransferase; | 99.93 | |
| 3dez_A | 243 | OPRT, oprtase, orotate phosphoribosyltransferase; | 99.93 | |
| 2p1z_A | 180 | Phosphoribosyltransferase; STRU genomics, PSI-2, p | 99.92 | |
| 2yzk_A | 178 | OPRT, oprtase, orotate phosphoribosyltransferase; | 99.92 | |
| 2wns_A | 205 | Orotate phosphoribosyltransferase; alternative spl | 99.92 | |
| 1y0b_A | 197 | Xanthine phosphoribosyltransferase; purine metabol | 99.92 | |
| 3mjd_A | 232 | Orotate phosphoribosyltransferase; IDP02311, csgid | 99.91 | |
| 1o57_A | 291 | PUR operon repressor; purine operon repressor, hel | 99.91 | |
| 1lh0_A | 213 | OMP synthase; loop closure, monomer closure, orota | 99.91 | |
| 1vch_A | 175 | Phosphoribosyltransferase-related protein; structu | 99.91 | |
| 2aee_A | 211 | OPRT, oprtase, orotate phosphoribosyltransferase; | 99.9 | |
| 3n2l_A | 238 | OPRT, oprtase, orotate phosphoribosyltransferase; | 99.9 | |
| 3qw4_B | 453 | UMP synthase; N-terminal orotidine monophosphate d | 99.89 | |
| 2ps1_A | 226 | Orotate phosphoribosyltransferase 1; alpha beta, o | 99.89 | |
| 3hvu_A | 204 | Hypoxanthine phosphoribosyltransferase; hypoxanthi | 99.8 | |
| 1vdm_A | 153 | Purine phosphoribosyltransferase; structural genom | 99.79 | |
| 1hgx_A | 183 | HGXPRTASE, hypoxanthine-guanine-xanthine phosphori | 99.79 | |
| 1fsg_A | 233 | HGPRTASE, hypoxanthine-guanine phosphoribosyltrans | 99.77 | |
| 1z7g_A | 217 | HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos | 99.75 | |
| 2geb_A | 185 | Hypoxanthine-guanine phosphoribosyltransferase; HG | 99.75 | |
| 1pzm_A | 211 | HGPRT, hypoxanthine-guanine phosphoribosyltransfer | 99.74 | |
| 2jbh_A | 225 | Phosphoribosyltransferase domain-containing prote; | 99.74 | |
| 3o7m_A | 186 | Hypoxanthine phosphoribosyltransferase; hypoxanthi | 99.73 | |
| 3ozf_A | 250 | Hypoxanthine-guanine-xanthine phosphoribosyltrans; | 99.73 | |
| 1tc1_A | 220 | Protein (hypoxanthine phosphoribosyltransferase); | 99.72 | |
| 1wd5_A | 208 | Hypothetical protein TT1426; structural genomics, | 99.72 | |
| 1yfz_A | 205 | Hypoxanthine-guanine phosphoribosyltransferase; pr | 99.72 | |
| 1a3c_A | 181 | PYRR, pyrimidine operon regulatory protein PYRR; t | 99.71 | |
| 2ywu_A | 181 | Hypoxanthine-guanine phosphoribosyltransferase; ro | 99.71 | |
| 3ohp_A | 177 | Hypoxanthine phosphoribosyltransferase; structural | 99.69 | |
| 1ufr_A | 181 | TT1027, PYR mRNA-binding attenuation protein; pyri | 99.67 | |
| 1nul_A | 152 | XPRT, xanthine-guanine phosphoribosyltransferase; | 99.66 | |
| 1w30_A | 201 | PYRR bifunctional protein; transferase, glycosyltr | 99.62 | |
| 1ecf_A | 504 | Glutamine phosphoribosylpyrophosphate amidotransf; | 99.6 | |
| 2xbu_A | 221 | Hypoxanthine-guanine phosphoribosyltransferase; gl | 99.58 | |
| 3acd_A | 181 | Hypoxanthine-guanine phosphoribosyltransferase; ro | 99.53 | |
| 1ao0_A | 459 | Glutamine phosphoribosylpyrophosphate amidotransfe | 99.52 | |
| 1dqn_A | 230 | Guanine phosphoribosyltransferase; protein-inhibit | 99.35 | |
| 1o5o_A | 221 | Uracil phosphoribosyltransferase; TM0721, structur | 99.33 | |
| 1i5e_A | 209 | Uracil phosphoribosyltransferase; salvage pathway; | 99.32 | |
| 2ehj_A | 208 | Uracil phosphoribosyltransferase; structural genom | 99.2 | |
| 2e55_A | 208 | Uracil phosphoribosyltransferase; structural genom | 99.19 | |
| 1v9s_A | 208 | Uracil phosphoribosyltransferase; pyrimidine salva | 99.14 | |
| 1bd3_D | 243 | Uprtase, uracil phosphoribosyltransferase; glycosy | 99.13 | |
| 3dmp_A | 217 | Uracil phosphoribosyltransferase; structural genom | 98.98 | |
| 1xtt_A | 216 | Probable uracil phosphoribosyltransferase; tetrame | 98.8 | |
| 3dah_A | 319 | Ribose-phosphate pyrophosphokinase; pyrophosphoki | 88.34 | |
| 1u9y_A | 284 | RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy | 86.77 | |
| 3s5j_B | 326 | Ribose-phosphate pyrophosphokinase 1; nucleotide s | 84.42 |
| >3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.8e-35 Score=252.66 Aligned_cols=186 Identities=20% Similarity=0.160 Sum_probs=146.3
Q ss_pred cccccceeeEEEeeecccCcccceeeeeeeee-e--------------eeeecceeeeeecCCCCCCeeheeHHHHhcCH
Q 028297 3 SEETRGYRAFLKQSVWCLTSQYQVSFSFFFLF-F--------------CFVFSSWSFFFFQIWWAAGIMFQDITTLLLDH 67 (211)
Q Consensus 3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~--------------~~~~~~~~~~~~~~~~~~~i~~~d~~~l~~~~ 67 (211)
.|||||+|||||||++.| +|+++|||+ + ++||++|++|+++..|+++|+.+.+++++...
T Consensus 45 ~esvrg~dV~iiqs~~~p-----~nd~lmeLl~~idA~k~asA~rIt~ViPY~~YaRQDr~~~~repisak~vA~lL~~~ 119 (326)
T 3s5j_B 45 GESVRGEDVYIVQSGCGE-----INDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVA 119 (326)
T ss_dssp CSCCTTCEEEEECCCCSC-----HHHHHHHHHHHHHHHHHTTCSEEEEEESSCTTTTCCSCTTSSCCCHHHHHHHHHHHH
T ss_pred CCCcCCCcEEEEecCCCC-----ccHHHHHHHHHHHHHHhcCCcEEEEeccCccccccCCcCCCCCCEeHHHHHHHHHHc
Confidence 489999999999999866 899999983 3 79999999999999999999999999998643
Q ss_pred HHHH-H---------------------HHHHHHHHHhh----cCCcEEEEecCCccchHHHHHHHhCCCeEEeecCCCCC
Q 028297 68 KAFK-D---------------------TVDIFVDRYRD----MGISVVAGIEARGFVFGPSIALAIGAKFVPLRKPNKLP 121 (211)
Q Consensus 68 ~~~~-~---------------------~~~~la~~i~~----~~~d~Iv~i~~gG~~~A~~lA~~L~~p~~~~~k~~~~~ 121 (211)
+..+ . ....+++++.+ .+.++|++|+.||+.+|..+|+.|++|+.+++|+++.+
T Consensus 120 G~drvit~DlH~~qiqgfF~ipvd~l~a~p~l~~~i~~~~~~~~~~vVVspd~Ggv~~A~~lA~~L~~~~~~i~K~r~~~ 199 (326)
T 3s5j_B 120 GADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKA 199 (326)
T ss_dssp TCSEEEEESCSSGGGGGGCSSCEEEECSHHHHHHHHHHHCTTGGGCEEEESSGGGHHHHHHHHHHHTCEEEEEEEC----
T ss_pred CCCEEEEEeCCChHHHhhcCCceeceEcHHHHHHHHHHhcCcCCCcEEEEECCCchHHHHHHHHHcCCCEEEEEEEecCC
Confidence 2111 0 12333333432 23579999999999999999999999999998877544
Q ss_pred CceeeeeeeeecCceeEEEecCCcCCCCEEEEEeccccchHHHHHHHHHHHhCCCeEEEEEEEEeCch--hhcccCCCCe
Q 028297 122 GEVISEAYVLEYGTDRLEMHVGAIEPGERALVIDDLVATGGTLSAAVRLLERMGAEVVECACVVGLPE--GQRRLDGKPL 199 (211)
Q Consensus 122 ~~~~~~~~~~~~~~~~~~~~~~~~~~gk~VLIVDDiitTG~Tl~~a~~~L~~~Ga~~V~v~~~~~~~~--~~~~l~~~~l 199 (211)
+... .+.+ .+. .+||+|+||||+++||+|+.++++.|+++||++|+++++|+.++ +.++|++.++
T Consensus 200 ~~v~-----------~~~l-~g~-v~gk~viIVDDii~TG~Tl~~a~~~L~~~Ga~~v~~~~tH~v~~~~a~e~l~~~~i 266 (326)
T 3s5j_B 200 NEVD-----------RMVL-VGD-VKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACF 266 (326)
T ss_dssp ---C-----------CEEE-ESC-CTTSEEEEEEEEESSCHHHHHHHHHHHHTTCSEEEEEEEEECCCTTHHHHHHHSCC
T ss_pred Ceee-----------EEec-ccc-CCCCEEEEEccccCCcHHHHHHHHHHHHcCCCEEEEEEEecccCchHHHHHhhCCC
Confidence 4321 1222 245 49999999999999999999999999999999999999999876 7888876677
Q ss_pred EEEEccc
Q 028297 200 YILVEPR 206 (211)
Q Consensus 200 ~sl~~~~ 206 (211)
..++..+
T Consensus 267 ~~vv~t~ 273 (326)
T 3s5j_B 267 EAVVVTN 273 (326)
T ss_dssp SEEEEET
T ss_pred CEEEEec
Confidence 7776544
|
| >3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* | Back alignment and structure |
|---|
| >1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* | Back alignment and structure |
|---|
| >3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* | Back alignment and structure |
|---|
| >2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* | Back alignment and structure |
|---|
| >2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* | Back alignment and structure |
|---|
| >1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A | Back alignment and structure |
|---|
| >1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* | Back alignment and structure |
|---|
| >1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* | Back alignment and structure |
|---|
| >3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* | Back alignment and structure |
|---|
| >3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* | Back alignment and structure |
|---|
| >3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} | Back alignment and structure |
|---|
| >1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* | Back alignment and structure |
|---|
| >1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A | Back alignment and structure |
|---|
| >1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} | Back alignment and structure |
|---|
| >2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* | Back alignment and structure |
|---|
| >3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* | Back alignment and structure |
|---|
| >1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A | Back alignment and structure |
|---|
| >1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* | Back alignment and structure |
|---|
| >2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} SCOP: c.61.1.0 | Back alignment and structure |
|---|
| >3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* | Back alignment and structure |
|---|
| >1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* | Back alignment and structure |
|---|
| >1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* | Back alignment and structure |
|---|
| >1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding P pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* | Back alignment and structure |
|---|
| >3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A | Back alignment and structure |
|---|
| >1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* | Back alignment and structure |
|---|
| >1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* | Back alignment and structure |
|---|
| >2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* | Back alignment and structure |
|---|
| >3acd_A Hypoxanthine-guanine phosphoribosyltransferase; rossmann fold, structural genomics, NPPSFA; HET: IMP; 1.89A {Thermus thermophilus} PDB: 3acc_A* 3acb_A* | Back alignment and structure |
|---|
| >1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* | Back alignment and structure |
|---|
| >1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* | Back alignment and structure |
|---|
| >1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* | Back alignment and structure |
|---|
| >3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} SCOP: c.61.1.1 | Back alignment and structure |
|---|
| >1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* | Back alignment and structure |
|---|
| >3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* | Back alignment and structure |
|---|
| >3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 211 | ||||
| d1zn7a1 | 178 | c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sap | 2e-38 | |
| d1qb7a_ | 236 | c.61.1.1 (A:) Adenine PRTase {Leishmania donovani | 4e-37 | |
| d1g2qa_ | 178 | c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Sacch | 4e-35 | |
| d1l1qa_ | 181 | c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [Tax | 6e-34 | |
| d1o57a2 | 202 | c.61.1.1 (A:75-276) Pur operon repressor (PurR), C | 1e-32 | |
| d1y0ba1 | 191 | c.61.1.1 (A:1-191) Xanthine phosphoribosyltransfer | 7e-31 | |
| d1vcha1 | 174 | c.61.1.1 (A:2-175) Putative phosphoribosyltransfer | 3e-29 | |
| d1wd5a_ | 208 | c.61.1.1 (A:) Putative phosphoribosyltransferase T | 3e-06 | |
| d2aeea1 | 208 | c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus p | 1e-05 | |
| d1nula_ | 150 | c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {E | 2e-04 | |
| d1xtta1 | 215 | c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus | 8e-04 | |
| d1v9sa1 | 208 | c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus the | 0.002 | |
| d1i5ea_ | 208 | c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldoly | 0.004 |
| >d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PRTase-like superfamily: PRTase-like family: Phosphoribosyltransferases (PRTases) domain: Adenine PRTase species: Human (Homo sapiens) [TaxId: 9606]
Score = 129 bits (324), Expect = 2e-38
Identities = 63/156 (40%), Positives = 99/156 (63%), Gaps = 5/156 (3%)
Query: 54 GIMFQDITTLLLDHKAFKDTVDIFVDRYRDM---GISVVAGIEARGFVFGPSIALAIGAK 110
G++F+DI+ +L D +F+ + + + I +AG+++RGF+FGPS+A +G
Sbjct: 21 GVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLG 80
Query: 111 FVPLRKPNKLPGEVISEAYVLEYGTDRLEMHVGAIEPGERALVIDDLVATGGTLSAAVRL 170
V +RK KLPG + +Y LEYG LE+ A+EPG+R +V+DDL+ATGGT++AA L
Sbjct: 81 CVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACEL 140
Query: 171 LERMGAEVVECACVVGLPE--GQRRLDGKPLYILVE 204
L R+ AEV+EC +V L G+ +L P + L++
Sbjct: 141 LGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQ 176
|
| >d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Length = 236 | Back information, alignment and structure |
|---|
| >d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 178 | Back information, alignment and structure |
|---|
| >d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Length = 181 | Back information, alignment and structure |
|---|
| >d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 202 | Back information, alignment and structure |
|---|
| >d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 191 | Back information, alignment and structure |
|---|
| >d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Length = 174 | Back information, alignment and structure |
|---|
| >d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Length = 208 | Back information, alignment and structure |
|---|
| >d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} Length = 208 | Back information, alignment and structure |
|---|
| >d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Length = 150 | Back information, alignment and structure |
|---|
| >d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Length = 215 | Back information, alignment and structure |
|---|
| >d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Length = 208 | Back information, alignment and structure |
|---|
| >d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Length = 208 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| d1zn7a1 | 178 | Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] | 100.0 | |
| d1g2qa_ | 178 | Adenine PRTase {Baker's yeast (Saccharomyces cerev | 100.0 | |
| d1l1qa_ | 181 | Adenine PRTase {Giardia lamblia [TaxId: 5741]} | 99.97 | |
| d1qb7a_ | 236 | Adenine PRTase {Leishmania donovani [TaxId: 5661]} | 99.96 | |
| d1o57a2 | 202 | Pur operon repressor (PurR), C-terminal domain {Ba | 99.94 | |
| d1y0ba1 | 191 | Xanthine phosphoribosyltransferase {Bacillus subti | 99.93 | |
| d2aeea1 | 208 | Orotate PRTase {Streptococcus pyogenes [TaxId: 131 | 99.92 | |
| d1vcha1 | 174 | Putative phosphoribosyltransferase TTHA1613 {Therm | 99.91 | |
| d1lh0a_ | 213 | Orotate PRTase {Salmonella typhimurium [TaxId: 903 | 99.84 | |
| d1u9ya2 | 129 | Phosphoribosylpyrophosphate synthetase {Methanocal | 99.81 | |
| d1dkua2 | 149 | Phosphoribosylpyrophosphate synthetase {Bacillus s | 99.81 | |
| d1vdma1 | 153 | Pprobable purine phosphoribosyltransferase PH0095 | 99.8 | |
| d2c4ka2 | 184 | PRPP synthetase-associated protein 1 {Human (Homo | 99.73 | |
| d1wd5a_ | 208 | Putative phosphoribosyltransferase TT1426 (TTHA146 | 99.66 | |
| d1hgxa_ | 173 | Hypoxanthine-guanine-xanthine PRTase {Tritrichomon | 99.59 | |
| d1yfza1 | 178 | Xanthine-guanine PRTase (XPRTase) {Thermoanaerobac | 99.56 | |
| d1nula_ | 150 | Xanthine-guanine PRTase (XPRTase) {Escherichia col | 99.54 | |
| d1tc1a_ | 184 | Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 569 | 99.5 | |
| d1j7ja_ | 172 | Hypoxanthine PRTase {Salmonella typhimurium [TaxId | 99.48 | |
| d1pzma_ | 183 | Hypoxanthine-guanine-xanthine PRTase {Leishmania t | 99.48 | |
| d1cjba_ | 228 | Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium | 99.43 | |
| d1z7ga1 | 214 | Hypoxanthine-guanine PRTase (HGPRTase) {Human (Hom | 99.43 | |
| d1ufra_ | 178 | Pyrimidine operon regulator PyrR {Thermus thermoph | 99.4 | |
| d1fsga_ | 233 | Hypoxanthine-guanine-xanthine PRTase {Toxoplasma g | 99.39 | |
| d1a3ca_ | 178 | Pyrimidine operon regulator PyrR {Bacillus subtili | 99.37 | |
| d1w30a_ | 182 | Pyrimidine operon regulator PyrR {Mycobacterium tu | 99.36 | |
| d1ecfa1 | 243 | Glutamine PRPP amidotransferase, C-terminal domain | 99.33 | |
| d1gph11 | 231 | Glutamine PRPP amidotransferase, C-terminal domain | 99.31 | |
| d1dqna_ | 230 | Guanine PRTase {Giardia lamblia [TaxId: 5741]} | 99.2 | |
| d1dkua1 | 159 | Phosphoribosylpyrophosphate synthetase {Bacillus s | 99.15 | |
| d2c4ka1 | 160 | PRPP synthetase-associated protein 1 {Human (Homo | 98.95 | |
| d1u9ya1 | 155 | Phosphoribosylpyrophosphate synthetase {Methanocal | 98.82 | |
| d1i5ea_ | 208 | Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: | 98.59 | |
| d1o5oa_ | 210 | Uracil PRTase, Upp {Thermotoga maritima [TaxId: 23 | 98.5 | |
| d1bd3a_ | 224 | Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811 | 98.46 | |
| d1v9sa1 | 208 | Uracil PRTase, Upp {Thermus thermophilus [TaxId: 2 | 98.41 | |
| d1xtta1 | 215 | Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId | 98.23 | |
| d2c4ka1 | 160 | PRPP synthetase-associated protein 1 {Human (Homo | 94.05 | |
| d1u9ya1 | 155 | Phosphoribosylpyrophosphate synthetase {Methanocal | 93.77 | |
| d1dkua1 | 159 | Phosphoribosylpyrophosphate synthetase {Bacillus s | 93.7 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 89.44 | |
| d1dcfa_ | 134 | Receiver domain of the ethylene receptor {Thale cr | 84.86 |
| >d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PRTase-like superfamily: PRTase-like family: Phosphoribosyltransferases (PRTases) domain: Adenine PRTase species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=8.2e-33 Score=218.71 Aligned_cols=162 Identities=40% Similarity=0.738 Sum_probs=147.8
Q ss_pred eeecCCCCCCeeheeHHHHhcCHHHHHHHHHHHHHHHhh---cCCcEEEEecCCccchHHHHHHHhCCCeEEeecCCCCC
Q 028297 45 FFFQIWWAAGIMFQDITTLLLDHKAFKDTVDIFVDRYRD---MGISVVAGIEARGFVFGPSIALAIGAKFVPLRKPNKLP 121 (211)
Q Consensus 45 ~~~~~~~~~~i~~~d~~~l~~~~~~~~~~~~~la~~i~~---~~~d~Iv~i~~gG~~~A~~lA~~L~~p~~~~~k~~~~~ 121 (211)
+.+|+||.+||.|+|+..++.+|+.++.+++.++++++. .++|.|++++.+|+++|..+|..|++|++++||+.+.+
T Consensus 12 ~~~pd~P~~Gi~f~Di~~il~~P~~~~~~~~~la~~~~~~~~~~~D~Iv~~e~~Gi~la~~lA~~l~~p~v~~Rk~~~~~ 91 (178)
T d1zn7a1 12 RSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLP 91 (178)
T ss_dssp EEEETSSSTTCEEEECHHHHHSHHHHHHHHHHHHHHHHHHHTTCCCEEEEETTGGGGTHHHHHHHHTCEEEEEEETTCCC
T ss_pred cccCCCCCCCCeEEECchhhhCHHHHHHHHHHHHhhhhhhcCCCcceEEEeccccchhhhhhHHHcCCCceEeeecCCCC
Confidence 568999999999999999999999999999999998865 37899999999999999999999999999999988888
Q ss_pred CceeeeeeeeecCceeEEEecCCcCCCCEEEEEeccccchHHHHHHHHHHHhCCCeEEEEEEEEeCch--hhcccCCCCe
Q 028297 122 GEVISEAYVLEYGTDRLEMHVGAIEPGERALVIDDLVATGGTLSAAVRLLERMGAEVVECACVVGLPE--GQRRLDGKPL 199 (211)
Q Consensus 122 ~~~~~~~~~~~~~~~~~~~~~~~~~~gk~VLIVDDiitTG~Tl~~a~~~L~~~Ga~~V~v~~~~~~~~--~~~~l~~~~l 199 (211)
.......+..+++...+++..+.+.+|++||||||+++||+|+.+++++++++||+++++++++++.+ |+++|+++|+
T Consensus 92 ~~~~~~~~~~~~~~~~~~~~~~~i~~g~rVlIVDDviaTGgT~~a~~~ll~~~Ga~vvg~~~ii~~~~~~g~~~l~~~pv 171 (178)
T d1zn7a1 92 GPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPF 171 (178)
T ss_dssp SSEEEEEEEETTEEEEEEEETTSSCTTCEEEEEEEEESSSHHHHHHHHHHHHTTCEEEEEEEEEEEGGGCHHHHHTTSCE
T ss_pred ccceeEEeeccccccceeeccCcccCCCeEEEehhhhhhchHHHHHHHHHHHCCCEEEEEEEEEEcCcCCHHHhcCCCCe
Confidence 77766666666666677777778889999999999999999999999999999999999999999886 8899999999
Q ss_pred EEEEccc
Q 028297 200 YILVEPR 206 (211)
Q Consensus 200 ~sl~~~~ 206 (211)
+||++++
T Consensus 172 ~SL~~~d 178 (178)
T d1zn7a1 172 FSLLQYE 178 (178)
T ss_dssp EEEEEEC
T ss_pred EEEEEeC
Confidence 9999875
|
| >d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} | Back information, alignment and structure |
|---|
| >d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} | Back information, alignment and structure |
|---|
| >d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} | Back information, alignment and structure |
|---|
| >d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} | Back information, alignment and structure |
|---|
| >d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} | Back information, alignment and structure |
|---|
| >d1dkua1 c.61.1.2 (A:8-166) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2c4ka1 c.61.1.2 (A:7-166) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u9ya1 c.61.1.2 (A:1-155) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2c4ka1 c.61.1.2 (A:7-166) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u9ya1 c.61.1.2 (A:1-155) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1dkua1 c.61.1.2 (A:8-166) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|