Citrus Sinensis ID: 028300


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MGSSSGQSNSYDLSFKILLIGDSGVGKSSLLVSFISSSVDDLSPTIGVDFKIKLLTVAGKRLKLTIWDTAGQERFRTLTSSYYRGAQGIILVYDVTRRETFTNLSDVWAKEVDLYSTNQDCVKMLVGNKVDRDSERVVSREEGIALAKEHGSLFLECSAKTRENVEQCFEQLALKIMEVPSLLEEGSNVVKRNILKQKPENQSPPIGGCCS
cccccccccccEEEEEEEEEccccccHHHHHHHccccccccccccccEEcEEEEEEEccEEEEEEEEEcccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccccHHHHHHHHHHHccEEEEccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc
************LSFKILLIGDSGVGKSSLLVSFISSSVDDLSPTIGVDFKIKLLTVAGKRLKLTIWDTAGQERFRTLTSSYYRGAQGIILVYDVTRRETFTNLSDVWAKEVDLYSTNQDCVKMLVGNKVDRDSERVVSREEGIALAKEHGSLFLECSAKTRENVEQCFEQLALKIMEVPS******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSSSGQSNSYDLSFKILLIGDSGVGKSSLLVSFISSSVDDLSPTIGVDFKIKLLTVAGKRLKLTIWDTAGQERFRTLTSSYYRGAQGIILVYDVTRRETFTNLSDVWAKEVDLYSTNQDCVKMLVGNKVDRDSERVVSREEGIALAKEHGSLFLECSAKTRENVEQCFEQLALKIMEVPSLLEEGSNVVKRNILKQKPENQSPPIGGCCS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein RABC2a Intracellular vesicle trafficking and protein transport.confidentO49841
Ras-related protein Rab-18 Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes.probableQ8MXS1
Ras-related protein Rab-18 Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.probableQ5ZLG1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CPJ, chain B
Confidence level:very confident
Coverage over the Query: 11-180
View the alignment between query and template
View the model in PyMOL
Template: 2J0V, chain A
Confidence level:very confident
Coverage over the Query: 11-178
View the alignment between query and template
View the model in PyMOL