Citrus Sinensis ID: 028320


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MPKQYLPLLGQPIALYSFYTFSRMVEVKEIVVVCDPSYSDIFEETKEKINVDLKFSLPGKERQDSVYSGLQEVDFNSELVCIHDSARPLVLSKDVQKVLMDALRVGAAVLGVPAKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPDLLKKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLIAERILNLSSESS
ccccccccccccHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHHHHHHHcccEEEEccccccEEEEcccccccccccHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHHcccccc
MPKQYLPLLGQPIALYSFYTFSRMVEVKEIVVVCDPSYSDIFEETKEKINVDLKFSLPGKERQDSVYSGLQEVDFNSELVCIHDSARPLVLSKDVQKVLMDALRVGAAVLGVPAKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPDLLKKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLIAERILNLS****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKQYLPLLGQPIALYSFYTFSRMVEVKEIVVVCDPSYSDIFEETKEKINVDLKFSLPGKERQDSVYSGLQEVDFNSELVCIHDSARPLVLSKDVQKVLMDALRVGAAVLGVPAKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPDLLKKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLIAERILNLSSESS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the formation of 4-diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D-erythritol 4-phosphate (MEP). Is essential for chloroplast development.probableQ5N8G1
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the formation of 4-diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D-erythritol 4-phosphate (MEP). Is essential for chloroplast development and required for pigments and gibberellins biosynthesis.probableP69834
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Catalyzes the formation of 4-diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D-erythritol 4-phosphate (MEP).probableQ2RFM0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.602-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YC3, chain A
Confidence level:very confident
Coverage over the Query: 2-205
View the alignment between query and template
View the model in PyMOL