Citrus Sinensis ID: 028327

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210

MATTSINMASAKFSMLGWIGGKRELKKKRVISISAQQQAEVEESRSKQVKENENQAQVKQQQTPLRPVEPQTNVRSKNMSREYGGQWLSCATRHVRIYAAYIDPETWEFDQTQMDKLTLILDPTKEFVWTDESCNKVFAYFQELVDHYEGALLTEYTLRLIGSDLEHYIRKLLYDGEIKYNMDARVLNFSMGKPRIMFNNNELPTQDVAQ

cccccccccccHHHHccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEEEccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHHccccccccccccccccccccEEEEcccccccccccc

*********SA*****GW*GGK************************************************************YGGQWLSCATRHVRIYAAYIDPETWEFDQTQMDKLTLILDPTKEFVWTDESCNKVFAYFQELVDHYEGALLTEYTLRLIGSDLEHYIRKLLYDGEIKYNMDARVLNFSMGKPRIMFN***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NAD(P)H-quinone oxidoreductase subunit M, chloroplastic	NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.	confident	A7NVJ4
NAD(P)H-quinone oxidoreductase subunit M, chloroplastic	NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.	probable	Q7FB12
NAD(P)H-quinone oxidoreductase subunit M, chloroplastic	NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.	probable	Q2V2S7

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DCU, chain A
Confidence level:probable
Coverage over the Query: 90-197
View the alignment between query and template
View the model in PyMOL