Citrus Sinensis ID: 028372

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MEDNNAIKRDVTELIGNTPMVYLNNVVDGCVARIAAKLETMEPCSSVKDRIAYSMIKDAEDKGLITPGKTTLIEVTSGNTGVGLAFIAAARGYNLIIVMPSTCSMERRIVLRALGAEIILADSALRFEEILEKGEEILKKTPDGYLLRQFENPANPKIHYETTGPEIWQDSGGKVDAFISGIGTGGTVTGAGRFLKENNPDIKVVLRVLL
ccccccHHHHHHHHHcccccEEEcccccccccEEEEEEEccccccccHHHHHHHHHHHHHHccccccccCEEEEccccHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHcccCEccccccccccHHHHHHcHHHHHHccccccccEEEEccccccccccHHHHHHHHccccEEEEEEcc
*****AI**DVTELIGNTPMVYLNNVVDGCVARIAAKLETMEPCSSVKDRIAYSMIKDAEDKGLITPGKTTLIEVTSGNTGVGLAFIAAARGYNLIIVMPSTCSMERRIVLRALGAEIILADSALRFEEILEKGEEILKKTPDGYLLRQFENPANPKIHYETTGPEIWQDSGGKVDAFISGIGTGGTVTGAGRFLKENNPDIKVVLRVLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDNNAIKRDVTELIGNTPMVYLNNVVDGCVARIAAKLETMEPCSSVKDRIAYSMIKDAEDKGLITPGKTTLIEVTSGNTGVGLAFIAAARGYNLIIVMPSTCSMERRIVLRALGAEIILADSALRFEEILEKGEEILKKTPDGYLLRQFENPANPKIHYETTGPEIWQDSGGKVDAFISGIGTGGTVTGAGRFLKENNPDIKVVLRVLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
O-acetylserine sulfhydrylase Catalyzes the conversion of O-acetylserine (OAS) to cysteine through the elimination of acetate and addition of hydrogen sulfide.probableO32978
Cysteine synthase probableQ5HRP1
Cysteine synthase Produces L-cysteine from O-acetyl-L-serine and hydrogen sulfide. Can also use pyrazole and 3,4-dihydroxypyridine instead of the hydrogen sulfide to produce two plant specific non-protein amino acids beta-pyrazolylalanine and L-mimosine.probableQ43317

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AEC, chain A
Confidence level:very confident
Coverage over the Query: 3-208
View the alignment between query and template
View the model in PyMOL