Citrus Sinensis ID: 028390


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MTMKKEEQATVTISAEYLCSHEVSELVSADSVLHYEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKMG
cccccccEEEEEEccccccccccccccccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
cccccccEEEEEEccHHccccccccccccccEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MTMKKEEQATVTISAEYLCSHEVSELVSADSVLHYEVTLIdftkekpfwkmdtHEKIEACErkkhdgnllfrAGKYWRASKKYEKAAKIIEFHhsftddekhqanglrlscylNNAACKLKLEDYSETSSLCTKvleleplnVKALYRRSQAHLKTSELEKAEADIKRAltidpnnrVVKLVYMELKDKQREYAKYQAEIFGTMLSKMG
mtmkkeeqatVTISAEYLCSHEVSELVSADSVLHYEVTLIdftkekpfwKMDTHEKIEacerkkhdgnllfRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEAdikraltidpnnrvvKLVYMELKDKQREYAKYQAEIFGTMLSKMG
MTMKKEEQATVTISAEYLCSHEVSELVSADSVLHYEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKMG
**********VTISAEYLCSHEVSELVSADSVLHYEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQA***********ADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGT******
MTMKKEEQATVTISAEYLCSHEVSELVSADSVLHYEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVKLVYMELK**************GTMLSKM*
**********VTISAEYLCSHEVSELVSADSVLHYEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKMG
****KEEQATVTISAEYLCSHEVSELVSADSVLHYEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKMG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTMKKEEQATVTISAEYLCSHEVSELVSADSVLHYEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVxxxxxxxxxxxxxxxxxxxxxIFGTMLSKMG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
Q38931551 Peptidyl-prolyl cis-trans yes no 0.995 0.377 0.523 8e-56
Q9FJL3578 Peptidyl-prolyl cis-trans no no 0.995 0.359 0.504 3e-55
Q43207559 70 kDa peptidyl-prolyl is N/A no 0.995 0.372 0.535 2e-53
Q95L05457 Peptidyl-prolyl cis-trans N/A no 0.985 0.450 0.322 3e-26
Q9XT11457 Peptidyl-prolyl cis-trans N/A no 0.985 0.450 0.322 5e-26
Q9XSI2457 Peptidyl-prolyl cis-trans N/A no 0.985 0.450 0.317 5e-26
Q13451457 Peptidyl-prolyl cis-trans yes no 0.985 0.450 0.317 1e-25
Q02790459 Peptidyl-prolyl cis-trans no no 0.985 0.448 0.322 1e-25
Q64378456 Peptidyl-prolyl cis-trans yes no 0.995 0.456 0.309 3e-25
Q9TRY0459 Peptidyl-prolyl cis-trans no no 0.985 0.448 0.312 4e-25
>sp|Q38931|FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2 Back     alignment and function desciption
 Score =  216 bits (550), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 148/212 (69%), Gaps = 4/212 (1%)

Query: 1   MTMKKEEQATVTISAEYLCSHEVSE----LVSADSVLHYEVTLIDFTKEKPFWKMDTHEK 56
           M MKK E A VTI  EY      S+    +V  +S + YEV L+ F KE+  W M+T EK
Sbjct: 337 MKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTFDKERESWDMNTEEK 396

Query: 57  IEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNA 116
           IEA  +KK +GN  F+ GKY  ASK+YEKA K IE+  SF+++EK QA  L+++C LN+A
Sbjct: 397 IEAASKKKEEGNSKFKGGKYSLASKRYEKAVKFIEYDTSFSEEEKKQAKALKVACNLNDA 456

Query: 117 ACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNN 176
           ACKLKL+DY +   LCTKVLELE  NVKALYRR+QA+++ S+L+ AE D+K+AL IDPNN
Sbjct: 457 ACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMELSDLDLAEFDVKKALEIDPNN 516

Query: 177 RVVKLVYMELKDKQREYAKYQAEIFGTMLSKM 208
           R VKL    LK+K +E+ K +A+ +G M +K+
Sbjct: 517 REVKLEQKRLKEKMKEFNKKEAKFYGNMFAKL 548




PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Co-chaperone that positively modulates thermotolerance by interacting with HSP90.1 and increasing the HSFA2-mediated accumulation of chaperones of the small-HSPs family.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 Back     alignment and function description
>sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 Back     alignment and function description
>sp|Q95L05|FKBP5_CHLAE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Chlorocebus aethiops GN=FKBP5 PE=2 SV=1 Back     alignment and function description
>sp|Q9XT11|FKBP5_AOTNA Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Aotus nancymaae GN=FKBP5 PE=2 SV=2 Back     alignment and function description
>sp|Q9XSI2|FKBP5_SAGOE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saguinus oedipus GN=FKBP5 PE=2 SV=2 Back     alignment and function description
>sp|Q13451|FKBP5_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens GN=FKBP5 PE=1 SV=2 Back     alignment and function description
>sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q64378|FKBP5_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Mus musculus GN=Fkbp5 PE=1 SV=1 Back     alignment and function description
>sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
255570494 523 peptidylprolyl isomerase, putative [Rici 1.0 0.399 0.698 6e-82
359481570 523 PREDICTED: LOW QUALITY PROTEIN: 70 kDa p 0.985 0.393 0.702 5e-81
356503354 538 PREDICTED: 70 kDa peptidyl-prolyl isomer 0.995 0.386 0.703 1e-77
224147353 548 predicted protein [Populus trichocarpa] 0.846 0.322 0.627 7e-68
356570407 533 PREDICTED: LOW QUALITY PROTEIN: 70 kDa p 0.985 0.386 0.604 1e-65
355329948 573 FK506-binding protein [Nicotiana tabacum 0.995 0.363 0.556 7e-60
224131530 577 predicted protein [Populus trichocarpa] 0.990 0.358 0.559 2e-57
118486491 608 unknown [Populus trichocarpa] 0.990 0.340 0.559 4e-57
255589766 574 peptidylprolyl isomerase, putative [Rici 0.995 0.362 0.537 6e-57
449463204 553 PREDICTED: peptidyl-prolyl cis-trans iso 0.995 0.376 0.542 7e-57
>gi|255570494|ref|XP_002526205.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223534483|gb|EEF36184.1| peptidylprolyl isomerase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  308 bits (790), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 146/209 (69%), Positives = 173/209 (82%)

Query: 1   MTMKKEEQATVTISAEYLCSHEVSELVSADSVLHYEVTLIDFTKEKPFWKMDTHEKIEAC 60
           MTMK+ E   VT++AEYL  H+ S+++ A+SVLHYEV LIDF K+KPFWKMD  EK+EAC
Sbjct: 315 MTMKRGEHCLVTVTAEYLSDHDSSDVLPANSVLHYEVQLIDFIKDKPFWKMDASEKLEAC 374

Query: 61  ERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKL 120
           E KK DGN+LF+AGK+WRASKKYEKA  I+E+ H FTDD+K  A GLRLSCYLNNAACKL
Sbjct: 375 EIKKLDGNVLFKAGKFWRASKKYEKATNIVEYDHPFTDDQKCLAKGLRLSCYLNNAACKL 434

Query: 121 KLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVK 180
           KL +Y E S LCTKVLE +P NVKAL+RRS+A+LK +ELEKAEADI +AL IDPNNR VK
Sbjct: 435 KLGEYCEASRLCTKVLEQDPFNVKALFRRSEAYLKITELEKAEADINKALIIDPNNRDVK 494

Query: 181 LVYMELKDKQREYAKYQAEIFGTMLSKMG 209
           L Y ELKDKQR YAK+QA++F TM S+MG
Sbjct: 495 LKYKELKDKQRVYAKHQAKLFSTMFSRMG 523




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359481570|ref|XP_003632641.1| PREDICTED: LOW QUALITY PROTEIN: 70 kDa peptidyl-prolyl isomerase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356503354|ref|XP_003520475.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] Back     alignment and taxonomy information
>gi|224147353|ref|XP_002336458.1| predicted protein [Populus trichocarpa] gi|222835069|gb|EEE73518.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356570407|ref|XP_003553380.1| PREDICTED: LOW QUALITY PROTEIN: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] Back     alignment and taxonomy information
>gi|355329948|dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|224131530|ref|XP_002321107.1| predicted protein [Populus trichocarpa] gi|222861880|gb|EEE99422.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118486491|gb|ABK95085.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255589766|ref|XP_002535081.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223524081|gb|EEF27302.1| peptidylprolyl isomerase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449463204|ref|XP_004149324.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis sativus] gi|449515125|ref|XP_004164600.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
UNIPROTKB|Q7F1F2580 OJ1191_A10.119 "cDNA clone:J03 0.995 0.358 0.523 1.6e-55
TAIR|locus:2152561578 ROF2 "AT5G48570" [Arabidopsis 0.995 0.359 0.514 2e-55
UNIPROTKB|Q9XFE4585 OSJNBa0091C07.4 "OSJNBa0091C07 0.990 0.353 0.542 3.4e-54
TAIR|locus:2090265562 ROF1 "AT3G25230" [Arabidopsis 0.995 0.370 0.523 1.5e-53
UNIPROTKB|Q6K5Q1682 P0579G08.8 "Putative peptidylp 0.995 0.304 0.488 9.9e-52
TAIR|locus:2037650164 TPR6 "AT1G58450" [Arabidopsis 0.751 0.957 0.481 9.5e-34
UNIPROTKB|A8J0I6569 FKB62 "Peptidyl-prolyl cis-tra 0.985 0.362 0.381 4.6e-32
UNIPROTKB|F1NIM4442 FKBP4 "Uncharacterized protein 0.985 0.466 0.331 2.7e-29
UNIPROTKB|F1NP08464 FKBP4 "Uncharacterized protein 0.985 0.443 0.331 2.7e-29
UNIPROTKB|Q95L05457 FKBP5 "Peptidyl-prolyl cis-tra 0.980 0.448 0.323 8.6e-28
UNIPROTKB|Q7F1F2 OJ1191_A10.119 "cDNA clone:J033121G16, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 549 (198.3 bits), Expect = 1.6e-55, Sum P(2) = 1.6e-55
 Identities = 111/212 (52%), Positives = 146/212 (68%)

Query:     1 MTMKKEEQATVTISAEYLCSHEVSE----LVSADSVLHYEVTLIDFTKEKPFWKMDTHEK 56
             + MK  E A VTI  EY      S+    +V  +S + YEV L+ F K+K  W ++  EK
Sbjct:   343 LNMKNGEVALVTIPPEYAFGSTESKQDLAVVPPNSTVIYEVELVSFVKDKESWDLNNTEK 402

Query:    57 IEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNA 116
             IE    KK +GN LF+ GKY RASK+YEKAAK IE+  SF++DEK Q+  L+++C LNNA
Sbjct:   403 IETAGAKKEEGNALFKLGKYVRASKRYEKAAKFIEYDSSFSEDEKKQSKQLKVTCNLNNA 462

Query:   117 ACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNN 176
             ACKLKL+DY +   LCTKVLEL+  NVKALYRR+QA+++ ++LE AE DIK+AL IDP+N
Sbjct:   463 ACKLKLKDYKQAEKLCTKVLELDSQNVKALYRRAQAYMQLADLELAEVDIKKALEIDPDN 522

Query:   177 RVVKLVYMELKDKQREYAKYQAEIFGTMLSKM 208
             R VKL Y  LK+K +EY K  A+ +  M +KM
Sbjct:   523 RDVKLTYKNLKEKVKEYNKKDAKFYSNMFAKM 554


GO:0000413 "protein peptidyl-prolyl isomerization" evidence=ISS
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS
GO:0005528 "FK506 binding" evidence=ISS
GO:0016020 "membrane" evidence=ISS
GO:0018208 "peptidyl-proline modification" evidence=ISS
TAIR|locus:2152561 ROF2 "AT5G48570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XFE4 OSJNBa0091C07.4 "OSJNBa0091C07.4 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2090265 ROF1 "AT3G25230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6K5Q1 P0579G08.8 "Putative peptidylprolyl isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2037650 TPR6 "AT1G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A8J0I6 FKB62 "Peptidyl-prolyl cis-trans isomerase, FKBP-type" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIM4 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NP08 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q95L05 FKBP5 "Peptidyl-prolyl cis-trans isomerase FKBP5" [Chlorocebus aethiops (taxid:9534)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.40480001
hypothetical protein (548 aa)
(Populus trichocarpa)
Predicted Functional Partners:
grail3.0051013901
hypothetical protein (181 aa)
       0.446

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-10
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 7e-06
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 7e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.001
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 0.002
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.002
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 56.2 bits (136), Expect = 1e-10
 Identities = 36/109 (33%), Positives = 49/109 (44%), Gaps = 15/109 (13%)

Query: 67  GNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYS 126
           GNL ++ G Y  A + YEKA ++   +                  Y N AA   KL  Y 
Sbjct: 7   GNLYYKLGDYDEALEYYEKALELDPDNAD---------------AYYNLAAAYYKLGKYE 51

Query: 127 ETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPN 175
           E      K LEL+P N KA Y    A+ K  + E+A    ++AL +DPN
Sbjct: 52  EALEDYEKALELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100


Length = 100

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 100.0
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.91
KOG0553304 consensus TPR repeat-containing protein [General f 99.89
KOG4234271 consensus TPR repeat-containing protein [General f 99.85
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.74
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.74
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.7
PRK15359144 type III secretion system chaperone protein SscB; 99.7
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.68
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.66
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.65
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.63
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.61
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.6
PRK11189296 lipoprotein NlpI; Provisional 99.51
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.5
PRK10370198 formate-dependent nitrite reductase complex subuni 99.47
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.47
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.47
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.46
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.46
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.42
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 99.4
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.38
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.38
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.36
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.34
KOG1126638 consensus DNA-binding cell division cycle control 99.33
PRK15359144 type III secretion system chaperone protein SscB; 99.33
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.33
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.32
PRK15331165 chaperone protein SicA; Provisional 99.32
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.31
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.3
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.3
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.29
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.28
PRK10370198 formate-dependent nitrite reductase complex subuni 99.28
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 99.28
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.27
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.26
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.25
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.25
PRK12370 553 invasion protein regulator; Provisional 99.24
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.24
PRK10803263 tol-pal system protein YbgF; Provisional 99.24
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.24
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.23
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.22
PRK12370553 invasion protein regulator; Provisional 99.22
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.21
KOG1126638 consensus DNA-binding cell division cycle control 99.21
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.21
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.2
PRK11189 296 lipoprotein NlpI; Provisional 99.2
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.19
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.17
PF1337173 TPR_9: Tetratricopeptide repeat 99.17
KOG1125579 consensus TPR repeat-containing protein [General f 99.16
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.16
KOG4555175 consensus TPR repeat-containing protein [Function 99.15
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.14
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.14
PF13512142 TPR_18: Tetratricopeptide repeat 99.13
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.13
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.12
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.12
KOG2076 895 consensus RNA polymerase III transcription factor 99.11
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.11
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.1
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.09
PRK11788389 tetratricopeptide repeat protein; Provisional 99.09
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.08
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.06
KOG0553 304 consensus TPR repeat-containing protein [General f 99.05
PLN02789 320 farnesyltranstransferase 99.05
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.04
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.01
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.99
PLN02789 320 farnesyltranstransferase 98.98
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 98.97
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.96
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.96
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.95
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.92
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.9
KOG2003 840 consensus TPR repeat-containing protein [General f 98.89
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.89
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.88
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.88
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.87
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.87
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.85
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.84
PF12688120 TPR_5: Tetratrico peptide repeat 98.84
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.83
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.83
PRK14574 822 hmsH outer membrane protein; Provisional 98.82
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.81
PF1337173 TPR_9: Tetratricopeptide repeat 98.81
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.8
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.8
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.77
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.76
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.75
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.75
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.75
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.73
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.72
KOG1129478 consensus TPR repeat-containing protein [General f 98.71
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 98.71
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.7
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.69
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.67
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.66
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.65
KOG2076 895 consensus RNA polymerase III transcription factor 98.61
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.6
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 98.6
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.58
KOG1129 478 consensus TPR repeat-containing protein [General f 98.58
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.57
PRK14574 822 hmsH outer membrane protein; Provisional 98.57
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.56
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.56
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.55
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.55
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 98.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.54
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.53
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.53
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 98.53
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.52
KOG4234271 consensus TPR repeat-containing protein [General f 98.48
KOG1125579 consensus TPR repeat-containing protein [General f 98.47
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.44
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.44
KOG2003 840 consensus TPR repeat-containing protein [General f 98.44
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.42
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.41
PRK10803263 tol-pal system protein YbgF; Provisional 98.41
KOG1310 758 consensus WD40 repeat protein [General function pr 98.4
PF1342844 TPR_14: Tetratricopeptide repeat 98.4
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 98.39
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.38
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.37
PF12688120 TPR_5: Tetratrico peptide repeat 98.34
PF1343134 TPR_17: Tetratricopeptide repeat 98.33
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.32
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.31
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.31
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.31
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.28
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.27
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 98.26
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.25
PF1342844 TPR_14: Tetratricopeptide repeat 98.25
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.21
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.21
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 98.2
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.2
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.19
PRK11906458 transcriptional regulator; Provisional 98.18
PRK15331165 chaperone protein SicA; Provisional 98.18
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.17
PRK10941269 hypothetical protein; Provisional 98.15
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 98.13
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 98.13
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 98.13
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.1
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.09
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.07
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.07
PRK11906458 transcriptional regulator; Provisional 98.06
PF13512142 TPR_18: Tetratricopeptide repeat 98.06
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.03
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.98
COG4700251 Uncharacterized protein conserved in bacteria cont 97.97
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.93
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.93
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.92
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.92
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 97.92
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.89
KOG4555175 consensus TPR repeat-containing protein [Function 97.86
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.83
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 97.81
KOG1586288 consensus Protein required for fusion of vesicles 97.77
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.76
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.73
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.7
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.67
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.66
KOG1941 518 consensus Acetylcholine receptor-associated protei 97.63
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.63
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.61
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.56
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.55
COG4105 254 ComL DNA uptake lipoprotein [General function pred 97.49
PF1343134 TPR_17: Tetratricopeptide repeat 97.47
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.46
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.46
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.43
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 97.4
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.37
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.37
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.37
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 97.36
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.36
KOG3364149 consensus Membrane protein involved in organellar 97.33
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.32
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.27
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.27
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.27
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.25
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.23
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.23
COG4700251 Uncharacterized protein conserved in bacteria cont 97.21
PLN03077 857 Protein ECB2; Provisional 97.17
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.16
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.15
KOG4814 872 consensus Uncharacterized conserved protein [Funct 97.15
PLN03218 1060 maturation of RBCL 1; Provisional 97.13
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.13
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.11
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.09
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 97.08
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.07
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.07
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.06
PLN03218 1060 maturation of RBCL 1; Provisional 97.05
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 97.01
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.99
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.96
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.96
COG2912269 Uncharacterized conserved protein [Function unknow 96.95
PRK04841 903 transcriptional regulator MalT; Provisional 96.95
PLN03077857 Protein ECB2; Provisional 96.94
PF06957422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 96.94
KOG1585308 consensus Protein required for fusion of vesicles 96.93
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.85
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.84
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.82
PRK04841 903 transcriptional regulator MalT; Provisional 96.81
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.76
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.73
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.65
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.63
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.6
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.58
KOG2471 696 consensus TPR repeat-containing protein [General f 96.55
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.52
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.5
COG3629280 DnrI DNA-binding transcriptional activator of the 96.47
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 96.46
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.45
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.34
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.33
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.32
PRK10941269 hypothetical protein; Provisional 96.25
COG3947361 Response regulator containing CheY-like receiver a 96.22
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.22
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.14
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 96.1
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.08
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.03
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.03
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.94
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.87
COG4976 287 Predicted methyltransferase (contains TPR repeat) 95.83
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 95.79
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.78
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.74
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.72
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.69
KOG1585 308 consensus Protein required for fusion of vesicles 95.66
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 95.57
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.57
KOG2300 629 consensus Uncharacterized conserved protein [Funct 95.48
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.47
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.45
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.31
KOG2471 696 consensus TPR repeat-containing protein [General f 95.17
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.08
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.7
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 94.51
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 94.5
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 94.45
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 94.44
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.44
COG5191 435 Uncharacterized conserved protein, contains HAT (H 94.35
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.35
KOG4814 872 consensus Uncharacterized conserved protein [Funct 94.33
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 94.28
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 94.11
KOG1586 288 consensus Protein required for fusion of vesicles 94.1
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 94.02
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 93.95
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 93.92
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.91
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.81
KOG3364149 consensus Membrane protein involved in organellar 93.78
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 93.72
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 93.68
COG3898 531 Uncharacterized membrane-bound protein [Function u 93.61
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 93.48
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 93.45
cd0267979 MIT_spastin MIT: domain contained within Microtubu 93.37
PF0421269 MIT: MIT (microtubule interacting and transport) d 93.18
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 93.17
KOG2300 629 consensus Uncharacterized conserved protein [Funct 93.05
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.04
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 92.87
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 92.76
COG2912269 Uncharacterized conserved protein [Function unknow 92.65
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.99
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 91.86
COG3118304 Thioredoxin domain-containing protein [Posttransla 91.75
KOG1550 552 consensus Extracellular protein SEL-1 and related 91.71
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 91.7
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 91.63
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 91.52
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 91.42
PHA02537230 M terminase endonuclease subunit; Provisional 91.42
KOG2047 835 consensus mRNA splicing factor [RNA processing and 91.18
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 91.13
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 90.98
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 90.85
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 90.71
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.62
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 90.56
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 90.42
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 90.17
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 90.14
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.93
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.73
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 89.54
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 89.48
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 89.3
KOG1497 399 consensus COP9 signalosome, subunit CSN4 [Posttran 89.23
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 89.03
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.96
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 88.95
smart0074577 MIT Microtubule Interacting and Trafficking molecu 88.93
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 88.68
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 88.57
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 88.52
KOG1310 758 consensus WD40 repeat protein [General function pr 88.31
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 88.02
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 87.82
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 87.78
PF13281374 DUF4071: Domain of unknown function (DUF4071) 87.62
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 87.35
KOG0529 421 consensus Protein geranylgeranyltransferase type I 86.81
cd0265675 MIT MIT: domain contained within Microtubule Inter 86.69
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.64
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 85.6
KOG1550 552 consensus Extracellular protein SEL-1 and related 85.51
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 85.44
COG4455 273 ImpE Protein of avirulence locus involved in tempe 85.26
KOG2047 835 consensus mRNA splicing factor [RNA processing and 85.2
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 83.83
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 83.78
KOG2041 1189 consensus WD40 repeat protein [General function pr 83.4
KOG1839 1236 consensus Uncharacterized protein CLU1/cluA/TIF31 83.34
COG3947361 Response regulator containing CheY-like receiver a 83.31
PF1285434 PPR_1: PPR repeat 83.24
COG3898 531 Uncharacterized membrane-bound protein [Function u 83.08
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 82.71
PF13281 374 DUF4071: Domain of unknown function (DUF4071) 82.59
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 82.21
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 81.79
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 81.42
KOG0529 421 consensus Protein geranylgeranyltransferase type I 80.93
KOG3783546 consensus Uncharacterized conserved protein [Funct 80.47
PF15469182 Sec5: Exocyst complex component Sec5 80.26
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.7e-41  Score=269.37  Aligned_cols=208  Identities=43%  Similarity=0.732  Sum_probs=201.8

Q ss_pred             CCCCccEEEEEeCccc-cc-ccCCcCCCCCCceEEEEEEEcccc-cCCCCCCCCHHHHHHHHHHHHHHhHHHHHcCCHHH
Q 028390            2 TMKKEEQATVTISAEY-LC-SHEVSELVSADSVLHYEVTLIDFT-KEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWR   78 (209)
Q Consensus         2 ~m~~ge~~~~~~~~~~-~~-~~~~~~~ip~~~~l~~~~~l~~~~-~~~~~~~~~~~~~~~~a~~~~~~g~~~~~~~~~~~   78 (209)
                      .|++||+|.|+|+|+| || ..++++.||||+++.|+|+|+.+. +....|.+...+++..+...++.|+.+|+.|+|..
T Consensus       147 ~M~~GE~a~v~i~~~YayG~~~~~~p~IPPnA~l~yEVeL~~f~~~~~~s~~~~~~e~l~~A~~~ke~Gn~~fK~gk~~~  226 (397)
T KOG0543|consen  147 MMKVGEVALVTIDPKYAYGEEGGEPPLIPPNATLLYEVELLDFELKEDESWKMFAEERLEAADRKKERGNVLFKEGKFKL  226 (397)
T ss_pred             hcCccceEEEEeCcccccCCCCCCCCCCCCCceEEEEEEEEeeecCcccccccchHHHHHHHHHHHHhhhHHHhhchHHH
Confidence            6999999999999999 99 445899999999999999999999 88889999988999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhhcCCCChHHHHHHHHHHHHHHhHHHHHHHhhcCHHHHHHHHHHHhhhCCCchHHHHHHHHHHhccCC
Q 028390           79 ASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSE  158 (209)
Q Consensus        79 A~~~y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~a~~~~~~~~  158 (209)
                      |...|.+|+.+++.+..+++++......+...+++|+|.|+++++.|..|+..|+++|.++|+|++++||+|.|+..+|+
T Consensus       227 A~~~Yerav~~l~~~~~~~~ee~~~~~~~k~~~~lNlA~c~lKl~~~~~Ai~~c~kvLe~~~~N~KALyRrG~A~l~~~e  306 (397)
T KOG0543|consen  227 AKKRYERAVSFLEYRRSFDEEEQKKAEALKLACHLNLAACYLKLKEYKEAIESCNKVLELDPNNVKALYRRGQALLALGE  306 (397)
T ss_pred             HHHHHHHHHHHhhccccCCHHHHHHHHHHHHHHhhHHHHHHHhhhhHHHHHHHHHHHHhcCCCchhHHHHHHHHHHhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCC
Q 028390          159 LEKAEADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKMG  209 (209)
Q Consensus       159 ~~~A~~~~~~a~~l~p~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~  209 (209)
                      ++.|..+|+++++++|+|..+...+..|.++++++..++++.|++||+.++
T Consensus       307 ~~~A~~df~ka~k~~P~Nka~~~el~~l~~k~~~~~~kekk~y~~mF~k~~  357 (397)
T KOG0543|consen  307 YDLARDDFQKALKLEPSNKAARAELIKLKQKIREYEEKEKKMYANMFAKLA  357 (397)
T ss_pred             HHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccc
Confidence            999999999999999999999999999999999999999999999998764



>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15469 Sec5: Exocyst complex component Sec5 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 8e-27
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 9e-27
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 4e-26
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 5e-25
2if4_A338 Crystal Structure Of A Multi-Domain Immunophilin Fr 2e-16
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 3e-16
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 7e-12
2fbn_A198 Plasmodium Falciparum Putative Fk506-Binding Protei 1e-10
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-10
4apo_A165 Aip Tpr Domain In Complex With Human Tomm20 Peptide 2e-09
4aif_A144 Aip Tpr Domain In Complex With Human Hsp90 Peptide 1e-07
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-05
3rkv_A162 C-Terminal Domain Of Protein C56c10.10, A Putative 7e-05
2c2l_A 281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 3e-04
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 3e-04
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 5e-04
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure

Iteration: 1

Score = 116 bits (291), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 66/208 (31%), Positives = 104/208 (50%), Gaps = 2/208 (0%) Query: 3 MKKEEQATVTISAEYLCSHEVSE--LVSADSVLHYEVTLIDFTKEKPFWKMDTHEKIEAC 60 M++EEQ + + Y + ++ L YEVTL F K K W+MDT EK+E Sbjct: 209 MQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQA 268 Query: 61 ERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKL 120 K G + F+ GKY +A +Y K +E + ++ E + L+ +LN A C L Sbjct: 269 AIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYL 328 Query: 121 KLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVK 180 KL +Y++ C K L L+ N K LYRR +A L +E E A+ D ++ L ++P N+ + Sbjct: 329 KLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAAR 388 Query: 181 LVYMELKDKQREYAKYQAEIFGTMLSKM 208 L + K +E+ + I+ M K Sbjct: 389 LQISMCQKKAKEHNERDRRIYANMFKKF 416
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|4APO|A Chain A, Aip Tpr Domain In Complex With Human Tomm20 Peptide Length = 165 Back     alignment and structure
>pdb|4AIF|A Chain A, Aip Tpr Domain In Complex With Human Hsp90 Peptide Length = 144 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|3RKV|A Chain A, C-Terminal Domain Of Protein C56c10.10, A Putative Peptidylprolyl Isomerase, From Caenorhabditis Elegans Length = 162 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-63
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 5e-61
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-51
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-49
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 8e-45
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 4e-39
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-31
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-22
3q49_B137 STIP1 homology and U box-containing protein 1; E3 4e-21
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 7e-21
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 9e-21
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 9e-21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-20
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 9e-20
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 7e-19
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-18
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 9e-18
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-16
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-12
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-12
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-16
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-14
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-11
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 8e-14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-13
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-13
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 8e-11
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-07
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-11
2gw1_A 514 Mitochondrial precursor proteins import receptor; 7e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-10
2gw1_A 514 Mitochondrial precursor proteins import receptor; 8e-08
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-07
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-05
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-04
2l6j_A111 TPR repeat-containing protein associated with HSP; 6e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 6e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 5e-07
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 6e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-10
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-10
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 8e-10
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 8e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-09
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 3e-06
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 5e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-09
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-08
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-05
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-09
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 2e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-05
3u4t_A 272 TPR repeat-containing protein; structural genomics 2e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 8e-05
3u4t_A 272 TPR repeat-containing protein; structural genomics 6e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-04
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 5e-07
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-05
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-04
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 3e-06
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 5e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-04
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 5e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-06
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 3e-06
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 4e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-04
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 4e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-04
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-05
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 5e-06
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 4e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 9e-06
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 8e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-05
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-05
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 5e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 8e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 4e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-04
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
 Score =  201 bits (512), Expect = 4e-63
 Identities = 66/211 (31%), Positives = 106/211 (50%), Gaps = 2/211 (0%)

Query: 1   MTMKKEEQATVTISAEYLC--SHEVSELVSADSVLHYEVTLIDFTKEKPFWKMDTHEKIE 58
             M++EEQ  + +   Y    + +    +  ++ L YEVTL  F K K  W+MDT EK+E
Sbjct: 207 EKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLE 266

Query: 59  ACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAAC 118
                K  G + F+ GKY +A  +Y K    +E  +  ++ E   +    L+ +LN A C
Sbjct: 267 QAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMC 326

Query: 119 KLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRV 178
            LKL +Y++    C K L L+  N K LYRR +A L  +E E A+ D ++ L ++P N+ 
Sbjct: 327 YLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKA 386

Query: 179 VKLVYMELKDKQREYAKYQAEIFGTMLSKMG 209
            +L     + K +E+ +    I+  M  K  
Sbjct: 387 ARLQISMCQKKAKEHNERDRRIYANMFKKFA 417


>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.98
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.97
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.96
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.93
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.9
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.9
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.88
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.85
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.81
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.81
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.78
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.78
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.77
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.76
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.75
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.73
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.72
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.71
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.71
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.7
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.69
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.69
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.68
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.68
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.67
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.67
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.67
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.67
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.66
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.65
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.64
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.62
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.62
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.61
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.61
3k9i_A117 BH0479 protein; putative protein binding protein, 99.6
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.6
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.6
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.59
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.58
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.58
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.57
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.56
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.56
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.54
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.54
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.54
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.54
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.54
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.53
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.53
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.52
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.52
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.51
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.51
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.49
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.49
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.49
3u4t_A 272 TPR repeat-containing protein; structural genomics 99.49
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.48
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.48
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.48
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.48
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.47
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.47
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.47
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.46
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.46
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.46
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.46
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.45
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.45
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.45
3u4t_A272 TPR repeat-containing protein; structural genomics 99.44
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.44
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.44
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.44
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.44
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.44
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.44
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.43
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.43
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.43
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.43
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.43
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.42
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.42
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.42
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.42
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.42
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.41
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.41
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.41
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.4
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.4
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.4
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.4
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.37
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.37
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.36
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.36
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.35
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.35
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.35
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.34
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.34
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.34
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.33
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.33
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.32
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.31
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.31
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.31
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.3
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.3
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.3
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.29
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.29
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.29
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.28
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.28
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.27
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.27
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.27
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.26
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.26
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.24
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.24
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.23
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.23
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.23
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.23
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.22
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.22
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.22
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.22
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.22
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.22
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.2
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.2
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.2
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 99.19
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.16
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.16
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.16
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.16
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 99.14
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.13
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.12
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.12
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.12
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.11
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.11
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.11
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.1
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.1
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.09
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.08
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.08
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.06
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.05
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.05
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.03
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.03
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.02
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.01
3k9i_A117 BH0479 protein; putative protein binding protein, 99.01
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.01
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.0
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.98
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.97
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.96
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.94
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.94
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.94
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 98.9
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.89
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.88
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.88
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.87
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 98.87
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.87
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.79
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.78
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.78
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.77
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.76
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.73
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.69
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.67
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.62
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.61
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 98.53
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.44
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.44
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.43
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.41
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.41
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.4
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.38
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.38
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.38
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.35
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.34
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.31
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.31
1jvw_A167 Macrophage infectivity potentiator; chagas disease 98.3
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.25
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 98.17
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.17
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 98.17
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 98.16
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.15
2ppn_A107 FK506-binding protein 1A; high resolution protein 98.15
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 98.12
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 98.12
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 98.11
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 98.09
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.08
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 98.04
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.01
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 98.0
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.0
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.96
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.85
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 97.84
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 97.81
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 97.73
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.7
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 97.57
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.48
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.4
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.39
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.3
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.27
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.13
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 97.08
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.07
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.05
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.8
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 96.76
3mv2_A325 Coatomer subunit alpha; vesicular membrane coat CO 96.68
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 96.67
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 96.43
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.15
3mkr_B320 Coatomer subunit alpha; tetratricopeptide repeats 95.89
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.79
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 95.57
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.56
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 95.53
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.08
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 95.07
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 94.58
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 94.32
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 93.66
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 93.59
2dl1_A116 Spartin; SPG20, MIT, structural genomics, NPPSFA, 93.49
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 93.44
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 92.46
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 92.19
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 91.94
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 91.07
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 90.56
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 90.51
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 90.44
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 90.15
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 89.91
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 89.91
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 89.84
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 89.49
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 89.3
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 88.96
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 88.71
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.48
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 87.55
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 85.86
1om2_A95 Protein (mitochondrial import receptor subunit TOM 85.62
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 84.85
3eab_A89 Spastin; spastin, MIT, ESCRT, alternative splicing 84.84
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 83.71
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 83.52
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 83.02
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 80.26
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
Probab=99.98  E-value=9.9e-30  Score=205.51  Aligned_cols=208  Identities=32%  Similarity=0.556  Sum_probs=197.8

Q ss_pred             CCCCCccEEEEEeCccc-ccccCCcC-CCCCCceEEEEEEEcccccCCCCCCCCHHHHHHHHHHHHHHhHHHHHcCCHHH
Q 028390            1 MTMKKEEQATVTISAEY-LCSHEVSE-LVSADSVLHYEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWR   78 (209)
Q Consensus         1 ~~m~~ge~~~~~~~~~~-~~~~~~~~-~ip~~~~l~~~~~l~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~~~~~~~~   78 (209)
                      ..|++||.+.++|.|.+ ||..|... .||+++.+.|.++|..+..+...+..........+..+...|+.++..|+|++
T Consensus        86 ~~~~~Ge~~~l~i~p~~ayg~~g~~~~~i~~~~~l~f~~~L~~~~~A~~~~~~a~~~~p~~a~~~~~~g~~~~~~g~~~~  165 (336)
T 1p5q_A           86 QRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQ  165 (336)
T ss_dssp             TTCCTTCEEEEEECTTTTTTTTCBGGGTBCSSCCEEEEEEEEEEECCCCGGGCCHHHHHHHHHHHHHHHHHHHHHTCHHH
T ss_pred             hcCCCCCeEEEEECCccccCcCCCCccCCCCCCeEEEEEEEeecccccchhcCCHHHHHHHHHHHHHHHHHHHHCCCHHH
Confidence            36999999999999999 99999665 69999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhhcCCCChHHHHHHHHHHHHHHhHHHHHHHhhcCHHHHHHHHHHHhhhCCCchHHHHHHHHHHhccCC
Q 028390           79 ASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSE  158 (209)
Q Consensus        79 A~~~y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~a~~~~~~~~  158 (209)
                      |+..|.+|+.+.|.......+......+....+|.++|.|+..+|+|++|+..|+++++++|++..+++++|.+|..+|+
T Consensus       166 A~~~y~~Al~~~p~~~~~~~~~~~~~~~~~~~~~~nla~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~g~  245 (336)
T 1p5q_A          166 ALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLSRRGEAHLAVND  245 (336)
T ss_dssp             HHHHHHHHHHHTTTCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHhhccccCChHHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHCCC
Confidence            99999999999998877666777788888899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcC
Q 028390          159 LEKAEADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKM  208 (209)
Q Consensus       159 ~~~A~~~~~~a~~l~p~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~  208 (209)
                      +++|+.+|+++++++|++..+...+..+...+++..++++..|++||+.+
T Consensus       246 ~~~A~~~~~~al~l~P~~~~a~~~l~~~~~~~~~~~~a~~~~~~~~~~~~  295 (336)
T 1p5q_A          246 FELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERL  295 (336)
T ss_dssp             HHHHHHHHHHHHHHCSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999865



>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dl1_A Spartin; SPG20, MIT, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>3eab_A Spastin; spastin, MIT, ESCRT, alternative splicing, ATP- binding, cytoplasm, disease mutation, hereditary spastic paraplegia, nucleotide-binding; 2.50A {Homo sapiens} Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-20
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-17
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-13
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 6e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-04
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 8e-06
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 2e-05
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-05
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-05
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 0.001
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 0.001
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.001
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 0.002
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.002
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.004
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP51, C-terminal domain
species: Monkey (Saimiri boliviensis) [TaxId: 27679]
 Score = 81.9 bits (201), Expect = 2e-20
 Identities = 52/163 (31%), Positives = 83/163 (50%)

Query: 46  KPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQAN 105
           K  W+MDT EK+E     K  G + F+ GKY +A  +Y K    +E  +  ++ E   + 
Sbjct: 1   KESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASE 60

Query: 106 GLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEAD 165
              L+ +LN A C LKL +Y++    C K L L+  N K LYRR +A L  +E E A+ D
Sbjct: 61  SFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGD 120

Query: 166 IKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKM 208
            ++ L ++P N+  +L     + K +E+ +     +  M  K 
Sbjct: 121 FEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFKKF 163


>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.97
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.97
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.94
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.87
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.82
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.73
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.73
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.66
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.65
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.64
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.63
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.57
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.56
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.56
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.55
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.53
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.53
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.5
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.48
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.47
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.46
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.45
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.44
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.42
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.42
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.39
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.19
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.14
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.14
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.14
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.13
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.04
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.0
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.99
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.93
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.93
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.92
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.78
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 98.72
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.71
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.67
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.67
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.63
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.62
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 98.6
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 98.59
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 98.59
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.57
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 98.56
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 98.55
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.53
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.52
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 98.46
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 98.44
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.21
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 98.06
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.86
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.54
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.43
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.42
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 94.02
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 93.53
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 93.32
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 91.44
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 90.36
d1om2a_95 Mitochondrial import receptor subunit Tom20 {Rat ( 83.95
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 81.67
d2ijqa1145 Hypothetical protein rrnAC1037 {Haloarcula marismo 81.56
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP52 (FKBP4), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1.9e-29  Score=183.42  Aligned_cols=161  Identities=34%  Similarity=0.593  Sum_probs=156.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHhHHHHHcCCHHHHHHHHHHHHHHHhhcCCCChHHHHHHHHHHHHHHhHHHHHHHhhcCHHH
Q 028390           48 FWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHHSFTDDEKHQANGLRLSCYLNNAACKLKLEDYSE  127 (209)
Q Consensus        48 ~~~~~~~~~~~~a~~~~~~g~~~~~~~~~~~A~~~y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~  127 (209)
                      .|+++.++++..+..+++.|+.+|+.|+|++|+..|++||.+++........+......+...+|.|+|.||+++|+|++
T Consensus         1 ~~~~~~~ek~~~a~~l~~~G~~~~~~~~~~~Ai~~y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~nla~~y~k~~~~~~   80 (170)
T d1p5qa1           1 SWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSA   80 (170)
T ss_dssp             GGGCCHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHTTTCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTTCHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHhhhccccchHHHhhhchhHHHHHHHHHHHHHhhhhccc
Confidence            48899999999999999999999999999999999999999999988888888889999999999999999999999999


Q ss_pred             HHHHHHHHhhhCCCchHHHHHHHHHHhccCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhc
Q 028390          128 TSSLCTKVLELEPLNVKALYRRSQAHLKTSELEKAEADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSK  207 (209)
Q Consensus       128 A~~~~~~al~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~a~~l~p~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~  207 (209)
                      |+.+++++|.++|+++.+++++|.||..+|++++|+.+|+++++++|+|+.+...+..+..++.+....++..|++||+.
T Consensus        81 A~~~~~~al~~~p~~~~a~~~~g~~~~~~g~~~~A~~~~~~al~l~P~n~~~~~~l~~~~~~~~~~~~~e~~~~~~~f~~  160 (170)
T d1p5qa1          81 AIESCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFER  160 (170)
T ss_dssp             HHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccchhhhhhhccccchhhhHHHHHHHHHhhhHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             C
Q 028390          208 M  208 (209)
Q Consensus       208 ~  208 (209)
                      +
T Consensus       161 ~  161 (170)
T d1p5qa1         161 L  161 (170)
T ss_dssp             H
T ss_pred             H
Confidence            5



>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2ijqa1 a.246.2.1 (A:14-158) Hypothetical protein rrnAC1037 {Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure