Citrus Sinensis ID: 028408

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MIMAISHSLMSIPTAMHISTLSQFESGVKSKLFVSASPSLRRPKRVSLSVIRAMGSSASSQKPDNIQGIHLLSSAEANRVDYASISDEEWKRRLTGEQYYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESSTKFDSGTGWPSYYQPIGSNMKSKLDLSIIFMPRQEVLCAVCDAHLGHVFDDGPPPTGKRYCINSASLKLKPK
ccEEcccccccccccEEEEcccEEEcccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHccccccccccccccccccEEEECccccccccccccccccccccccccccccccEEEEEccccccCEEEEEccccccccccccccccccccccccccccccccccc
*************TAMHISTLSQFESGV**************PKRVSLSVIRAMGSS************HLL*****NRVDYASISDEEWKRRLTGEQYYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESSTKFDSGTGWPSYYQPIGSNMKSKLDLSIIFMPRQEVLCAVCDAHLGHVFDDGPPPTGKRYCINSASLKLKP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIMAISHSLMSIPTAMHISTLSQFESGVKSKLFVSASPSLRRPKRVSLSVIRAMGSSASSQKPDNIQGIHLLSSAEANRVDYASISDEEWKRRLTGEQYYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESSTKFDSGTGWPSYYQPIGSNMKSKLDLSIIFMPRQEVLCAVCDAHLGHVFDDGPPPTGKRYCINSASLKLKPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide methionine sulfoxide reductase B1, chloroplastic Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Specifically reduces the MetSO R-enantiomer. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. May play an essential function in association with MSRB2 in maintaining vegetative growth during environmental constraints, through the preservation of photosynthetic antennae. MSRB1 and MSRB2 account for most of the leaf peptide MSR capacity.probableQ9C8M2
Peptide methionine sulfoxide reductase MsrB probableO26807
Peptide methionine sulfoxide reductase MsrB probableQ21LK2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.8.-.-Acting on a sulfur group of donors.probable
1.8.4.-With a disulfide as acceptor.probable
1.8.4.12Peptide-methionine (R)-S-oxide reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E0M, chain A
Confidence level:very confident
Coverage over the Query: 81-209
View the alignment between query and template
View the model in PyMOL