Citrus Sinensis ID: 028441


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MEVKLWNDKREREMYENFAELYAIIKATEKLEKAYVRDIISSSEYETECQKLIAHFKTLSSTLKDIVPSIERFADTYKMDCPAALNRLVTSGVPATVEHRAAAVASTTTSAAIVAECVQNFITAMDSLKLNMVAVDQVHPLLSDLLGSLNKLTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSFMAALPNAGT
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHccccccEEcccccccccccccHHHHHHccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccc
*EVKLW*DKREREMYENFAELYAIIKATEKLEKAYVRDIISSSEYETECQKLIAHFKTLSSTLKDIVPSIERFADTYKMDCPAALNRLVTSGVPATVEHRAA*V**TTTSAAIVAECVQNFITAMDSLKLNMVAVDQVHPLLSDLLGSLNKLTILPPDFEGKTKMKDWISRLS************SRQLHFDLESSYNSFM*ALP****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVKLWNDKREREMYENFAELYAIIKATEKLEKAYVRDIISSSEYETECQKLIAHFKTLSSTLKDIVPSIERFADTYKMDCPAALNRLVTSGVPATVEHRAAAVASTTTSAAIVAECVQNFITAMDSLKLNMVAVDQVHPLLSDLLGSLNKLTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSFMAALPNAGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 28 homolog 2 Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association to the ESCRT-0 complex.confidentQ9S9T7
Vacuolar protein sorting-associated protein 28 Component of the ESCRT-I complex, a regulator of vesicular trafficking process.probableQ54NF1
Vacuolar protein sorting-associated protein 28 homolog Component of the ESCRT-I complex, a regulator of vesicular trafficking process.probableQ9V359

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J9W, chain A
Confidence level:very confident
Coverage over the Query: 106-205
View the alignment between query and template
View the model in PyMOL
Template: 2CAZ, chain B
Confidence level:very confident
Coverage over the Query: 4-97
View the alignment between query and template
View the model in PyMOL