Citrus Sinensis ID: 028455


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MEGIIVRRVIPSDNSCLFNAVGYVMEHDKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQEYR
cccEEEEEEccccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHccccccccHHHHHHHHHHcccEEEEEEcccccEEEcccccccccEEEEEEccccccCEEEccccccccccccEEECccccccccHHHHHHHHHHHHHHHccccccccccEEEccccccccccHHHHHHHHHHHccccccccc
*EGIIVRRVIPSDNSCLFNAVGYVMEHDKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQ***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGIIVRRVIPSDNSCLFNAVGYVMEHDKNKAPELRQVIAATVASDPVKYSEAFLGKSNQEYCSWIQDPEKWGGAIELSILADYYGREIAAYDIQTTRCDLYGQEKKYSERVMLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQEYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin thioesterase OTU1 Hydrolase that can remove conjugated ubiquitin from proteins and may therefore play an important regulatory role at the level of protein turnover by preventing degradation.probableQ55BI3
Ubiquitin thioesterase OTU1 Hydrolase that can remove conjugated ubiquitin from proteins and participates in endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by triming the ubiquitin chain on the associated substrate to facilitate their threading through the VCP/p97 pore. Ubiquitin moieties on substrates may present a steric impediment to the threading process when the substrate is transferred to the VCP pore and threaded through VCP's axial channel.probableQ5F3A6
Ubiquitin thioesterase OTU1 Hydrolase that can remove conjugated ubiquitin from proteins and participates in endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by triming the ubiquitin chain on the associated substrate to facilitate their threading through the VCP/p97 pore. Ubiquitin moieties on substrates may present a steric impediment to the threading process when the substrate is transferred to the VCP pore and threaded through VCP's axial channel.probableQ567B1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BY4, chain A
Confidence level:very confident
Coverage over the Query: 2-170
View the alignment between query and template
View the model in PyMOL