Citrus Sinensis ID: 028464


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MATKTRLVSVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL
ccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEccEEEEEEEEEEccccccHHHHHHHHHHHccccccccccccccccccccEEccccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEcccccccccccEEEEEEEEcHHHHHHHHHcccccccccccEEEEccccccc
*****RLVSVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKI*************VVISNSGEMAL
xxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATKTRLVSVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase CYP19-4 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved during embryogenesis and organ development by regulating the folding of EMB30/GNOM, and thus, by modulating its activity.confidentQ8LDP4
Peptidyl-prolyl cis-trans isomerase 7 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.confidentP52015
Peptidyl-prolyl cis-trans isomerase B PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.probableP0CP78

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QNG, chain A
Confidence level:very confident
Coverage over the Query: 37-206
View the alignment between query and template
View the model in PyMOL