Citrus Sinensis ID: 028464

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MATKTRLVSVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL
ccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEccEEEEEEEEEEccccccHHHHHHHHHHHccccccccccccccccccccEEccccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEcccccccccccEEEEEEEEcHHHHHHHHHcccccccccccEEEEccccccc
cccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHccccEcccccEccccccEccEEEcccEEEEccccccccccccccccccEcccccccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEEEEEcHHHHHHHHccccccccccccEEEEEEEEccc
MATKTRLVSVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDievggkpigrivmglfgkavPKTVENFRALCtgekgigksgkplyykgssfhriipsfmiqggdftlgdgrggesifgesfadenfklkhtgpgvlsmanagpdtngsqFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAegrqsgepkskvvisnsgemal
MATKTRLVSVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALctgekgigksgkpLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIeaegrqsgepkskvvisnsgemal
MATKTRlvsvallwalvlfltlaFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQggdftlgdgrggESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL
*****RLVSVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSM******TNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKI************************
*********VALLWALVLFLTLA****************KVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVR***************VVISNSGEMAL
MATKTRLVSVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAE*********KVVISNSGEMAL
****TRLVSVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATKTRLVSVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query208 2.2.26 [Sep-21-2011]
Q8LDP4201 Peptidyl-prolyl cis-trans yes no 0.947 0.980 0.77 1e-85
Q9SP02204 Peptidyl-prolyl cis-trans no no 0.884 0.901 0.804 1e-83
Q9TW32197 Peptidyl-prolyl cis-trans yes no 0.932 0.984 0.659 6e-72
P52015171 Peptidyl-prolyl cis-trans yes no 0.802 0.976 0.700 6e-68
P52011173 Peptidyl-prolyl cis-trans no no 0.802 0.965 0.694 6e-66
Q39613172 Peptidyl-prolyl cis-trans N/A no 0.807 0.976 0.672 1e-64
Q9SKQ0174 Peptidyl-prolyl cis-trans no no 0.807 0.965 0.666 3e-64
Q01490203 Peptidyl-prolyl cis-trans N/A no 0.889 0.911 0.637 9e-64
P21568171 Peptidyl-prolyl cis-trans N/A no 0.802 0.976 0.664 1e-63
Q54SM3179 Peptidyl-prolyl cis-trans no no 0.802 0.932 0.682 2e-63
>sp|Q8LDP4|CP19D_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-4 OS=Arabidopsis thaliana GN=CYP19-4 PE=1 SV=2 Back     alignment and function desciption
 Score =  315 bits (808), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 175/200 (87%), Gaps = 3/200 (1%)

Query: 9   SVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTV 68
           S  LL  L LF  +A IQ   ++E+L++VTHKVYFD+E+ GK  GR+V+GLFGKAVPKT 
Sbjct: 5   SFILLGTLFLFGAIASIQ---AKEDLKEVTHKVYFDVEIDGKSAGRVVIGLFGKAVPKTA 61

Query: 69  ENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADE 128
           ENFRALCTGEKG+GKSGKPL+YKGS FHRIIPSFMIQGGDFT G+G GGESI+G+ FADE
Sbjct: 62  ENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADE 121

Query: 129 NFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAEG 188
           NFKLKHTGPGVLSMAN+G DTNGSQFFITTV TSWLDGRHVVFGKV+ GMDVV KIEAEG
Sbjct: 122 NFKLKHTGPGVLSMANSGEDTNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKIEAEG 181

Query: 189 RQSGEPKSKVVISNSGEMAL 208
           +QSG PKSKVVI++SGE+ L
Sbjct: 182 KQSGTPKSKVVIADSGELPL 201
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved during embryogenesis and organ development by regulating the folding of EMB30/GNOM, and thus, by modulating its activity.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9SP02|CP20A_ARATH Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Arabidopsis thaliana GN=CYP20-1 PE=1 SV=1 Back     alignment and function description
>sp|Q9TW32|PPIB_DICDI Peptidyl-prolyl cis-trans isomerase B OS=Dictyostelium discoideum GN=cypB PE=1 SV=1 Back     alignment and function description
>sp|P52015|CYP7_CAEEL Peptidyl-prolyl cis-trans isomerase 7 OS=Caenorhabditis elegans GN=cyn-7 PE=1 SV=2 Back     alignment and function description
>sp|P52011|CYP3_CAEEL Peptidyl-prolyl cis-trans isomerase 3 OS=Caenorhabditis elegans GN=cyn-3 PE=1 SV=1 Back     alignment and function description
>sp|Q39613|CYPH_CATRO Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus GN=PCKR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SKQ0|CP19B_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana GN=CYP19-2 PE=1 SV=1 Back     alignment and function description
>sp|Q01490|PPIB_ORPSP Peptidyl-prolyl cis-trans isomerase B OS=Orpinomyces sp. (strain PC-2) GN=CYPB PE=1 SV=1 Back     alignment and function description
>sp|P21568|CYPH_SOLLC Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum GN=CYP PE=2 SV=1 Back     alignment and function description
>sp|Q54SM3|PPIA_DICDI Peptidyl-prolyl cis-trans isomerase A OS=Dictyostelium discoideum GN=ppiA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
210063564207 cyclophilin [Camellia oleifera] 0.985 0.990 0.809 6e-94
224104269207 predicted protein [Populus trichocarpa] 0.966 0.971 0.805 1e-92
395146517206 peptidyl-prolyl cis-trans isomerase [Lin 0.980 0.990 0.794 9e-92
118481371207 unknown [Populus trichocarpa] 0.985 0.990 0.785 1e-91
224109324231 predicted protein [Populus trichocarpa] 1.0 0.900 0.722 3e-91
255569359204 cyclophilin, putative [Ricinus communis] 0.913 0.931 0.836 3e-90
118485138231 unknown [Populus trichocarpa] 1.0 0.900 0.718 3e-90
152206078207 cyclophilin-like protein [Nicotiana taba 0.995 1.0 0.783 6e-90
225448429208 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 1.0 0.764 1e-89
56694218225 putative cyclophilin [Solanum lycopersic 0.990 0.915 0.726 7e-88
>gi|210063564|gb|ACJ06541.1| cyclophilin [Camellia oleifera] Back     alignment and taxonomy information
 Score =  348 bits (894), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 166/205 (80%), Positives = 183/205 (89%)

Query: 4   KTRLVSVALLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKA 63
           +TR  S+AL+W LVLF TLA  Q   S+E+L++VTHKVYFD+E+ GKP GRIVMGLFGKA
Sbjct: 3   RTRSFSLALVWTLVLFATLALTQAKKSKEDLKEVTHKVYFDVEIAGKPAGRIVMGLFGKA 62

Query: 64  VPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGE 123
           VPKT ENFRALCTGEKG+GKSGKPL+YKGS FHRIIPSFM+QGGDFTLGDGRGGESI+G 
Sbjct: 63  VPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMLQGGDFTLGDGRGGESIYGG 122

Query: 124 SFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRK 183
            FADENFKLKHTGPG+LSMANAGPDTNGSQFFITTV TSWLDGRHVVFGKVLSGMDVV K
Sbjct: 123 EFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYK 182

Query: 184 IEAEGRQSGEPKSKVVISNSGEMAL 208
           IEAEG QSG PKS V I++SGE+ L
Sbjct: 183 IEAEGNQSGTPKSNVQIADSGELPL 207

Source: Camellia oleifera

Species: Camellia oleifera

Genus: Camellia

Family: Theaceae

Order: Ericales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224104269|ref|XP_002313378.1| predicted protein [Populus trichocarpa] gi|118483106|gb|ABK93462.1| unknown [Populus trichocarpa] gi|118483497|gb|ABK93647.1| unknown [Populus trichocarpa] gi|118488634|gb|ABK96129.1| unknown [Populus trichocarpa] gi|222849786|gb|EEE87333.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|395146517|gb|AFN53672.1| peptidyl-prolyl cis-trans isomerase [Linum usitatissimum] Back     alignment and taxonomy information
>gi|118481371|gb|ABK92628.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224109324|ref|XP_002315159.1| predicted protein [Populus trichocarpa] gi|222864199|gb|EEF01330.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255569359|ref|XP_002525647.1| cyclophilin, putative [Ricinus communis] gi|223535083|gb|EEF36765.1| cyclophilin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118485138|gb|ABK94432.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|152206078|gb|ABS30424.1| cyclophilin-like protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|225448429|ref|XP_002273152.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|56694218|gb|AAW22880.1| putative cyclophilin [Solanum lycopersicum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
TAIR|locus:2045663201 CYP5 "cyclophilin 5" [Arabidop 0.860 0.890 0.759 6.7e-72
TAIR|locus:2178863204 ROC7 "rotamase CYP 7" [Arabido 0.884 0.901 0.755 8.6e-72
TAIR|locus:2081993228 AT3G55920 [Arabidopsis thalian 0.850 0.776 0.717 3.1e-67
DICTYBASE|DDB_G0269120197 cypB "cyclophilin B" [Dictyost 0.822 0.868 0.672 4.3e-61
WB|WBGene00000883171 cyn-7 [Caenorhabditis elegans 0.802 0.976 0.646 6.6e-58
WB|WBGene00000879173 cyn-3 [Caenorhabditis elegans 0.802 0.965 0.640 5.3e-56
UNIPROTKB|P52011173 cyn-3 "Peptidyl-prolyl cis-tra 0.802 0.965 0.640 5.3e-56
WB|WBGene00000878172 cyn-2 [Caenorhabditis elegans 0.802 0.970 0.652 6.1e-55
TAIR|locus:2047097174 AT2G21130 [Arabidopsis thalian 0.807 0.965 0.613 3.4e-54
DICTYBASE|DDB_G0282359179 ppiA "cyclophilin-type peptidy 0.802 0.932 0.628 4.9e-53
TAIR|locus:2045663 CYP5 "cyclophilin 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 727 (261.0 bits), Expect = 6.7e-72, P = 6.7e-72
 Identities = 136/179 (75%), Positives = 155/179 (86%)

Query:    30 SREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLY 89
             ++E+L++VTHKVYFD+E+ GK  GR+V+GLFGKAVPKT ENFRALCTGEKG+GKSGKPL+
Sbjct:    23 AKEDLKEVTHKVYFDVEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLH 82

Query:    90 YKGSSFHRIIPSFMIQXXXXXXXXXXXXESIFGESFADENFKLKHTGPGVLSMANAGPDT 149
             YKGS FHRIIPSFMIQ            ESI+G+ FADENFKLKHTGPGVLSMAN+G DT
Sbjct:    83 YKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGEDT 142

Query:   150 NGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEMAL 208
             NGSQFFITTV TSWLDGRHVVFGKV+ GMDVV KIEAEG+QSG PKSKVVI++SGE+ L
Sbjct:   143 NGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGELPL 201
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005771 "multivesicular body" evidence=IDA
GO:0005795 "Golgi stack" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006623 "protein targeting to vacuole" evidence=RCA
TAIR|locus:2178863 ROC7 "rotamase CYP 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081993 AT3G55920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269120 cypB "cyclophilin B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00000883 cyn-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00000879 cyn-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P52011 cyn-3 "Peptidyl-prolyl cis-trans isomerase 3" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00000878 cyn-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2047097 AT2G21130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282359 ppiA "cyclophilin-type peptidylprolyl cis-trans isomerase (PPIase)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P23284PPIB_HUMAN5, ., 2, ., 1, ., 80.58120.93750.9027yesno
Q39613CYPH_CATRO5, ., 2, ., 1, ., 80.67260.80760.9767N/Ano
P0CP78PPIB_CRYNJ5, ., 2, ., 1, ., 80.60380.97590.8787yesno
P0CP79PPIB_CRYNB5, ., 2, ., 1, ., 80.60380.97590.8787N/Ano
Q9TW32PPIB_DICDI5, ., 2, ., 1, ., 80.65980.93260.9847yesno
P0C1I7CYP5_RHIO95, ., 2, ., 1, ., 80.67060.80280.9488N/Ano
Q8X166PPIB_ASPNG5, ., 2, ., 1, ., 80.60.91340.8962yesno
P52010CYP2_CAEEL5, ., 2, ., 1, ., 80.70650.80280.9709nono
O49886CYPH_LUPLU5, ., 2, ., 1, ., 80.64280.80760.9767N/Ano
P21568CYPH_SOLLC5, ., 2, ., 1, ., 80.66460.80280.9766N/Ano
P21569CYPH_MAIZE5, ., 2, ., 1, ., 80.65470.80760.9767N/Ano
P0C1I8CYP6_RHIO95, ., 2, ., 1, ., 80.64670.80280.9488N/Ano
Q8LDP4CP19D_ARATH5, ., 2, ., 1, ., 80.770.94710.9800yesno
Q6C4W6PPIB_YARLI5, ., 2, ., 1, ., 80.60600.88940.8114yesno
P80311PPIB_BOVIN5, ., 2, ., 1, ., 80.59510.92780.8935yesno
Q9SP02CP20A_ARATH5, ., 2, ., 1, ., 80.80430.88460.9019nono
O93826PPIB_ARTBE5, ., 2, ., 1, ., 80.58090.94230.8672N/Ano
P73789PPI2_SYNY35, ., 2, ., 1, ., 80.65260.80280.9766N/Ano
P52015CYP7_CAEEL5, ., 2, ., 1, ., 80.70050.80280.9766yesno
P24525CYPH_BRANA5, ., 2, ., 1, ., 80.67640.81730.9941N/Ano
Q01490PPIB_ORPSP5, ., 2, ., 1, ., 80.63730.88940.9113N/Ano
P24369PPIB_MOUSE5, ., 2, ., 1, ., 80.60590.93750.9027yesno
P24368PPIB_RAT5, ., 2, ., 1, ., 80.60090.93750.9027yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.983
4th Layer5.2.1.80.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 1e-108
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 1e-94
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 2e-72
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 2e-62
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 5e-62
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 1e-59
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 4e-52
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 5e-50
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 8e-47
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 2e-43
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 3e-38
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 3e-31
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 1e-27
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 2e-20
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 3e-16
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 1e-15
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 1e-08
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information 
 Score =  308 bits (790), Expect = e-108
 Identities = 122/166 (73%), Positives = 139/166 (83%), Gaps = 2/166 (1%)

Query: 39  HKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRI 98
            KV+FDI +GG+P GRIVM LF   VPKT ENFRALCTGEKG G  GKP  YKGS+FHR+
Sbjct: 1   PKVFFDITIGGEPAGRIVMELFADVVPKTAENFRALCTGEKGKG--GKPFGYKGSTFHRV 58

Query: 99  IPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITT 158
           IP FMIQGGDFT G+G GG+SI+GE F DENFKLKHTGPG+LSMANAGP+TNGSQFFITT
Sbjct: 59  IPDFMIQGGDFTRGNGTGGKSIYGEKFPDENFKLKHTGPGLLSMANAGPNTNGSQFFITT 118

Query: 159 VITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSG 204
           V T WLDG+HVVFGKV+ GMDVV+KIE  G  +G+PK KVVI++ G
Sbjct: 119 VKTPWLDGKHVVFGKVVEGMDVVKKIENVGSGNGKPKKKVVIADCG 164

This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. These enzymes have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. As cyclophilins, Human hCyP-A, human cyclophilin-B (hCyP-19), S. cerevisiae Cpr1 and C. elegans Cyp-3, are inhibited by the immunosuppressive drug cyclopsporin A (CsA). CsA binds to the PPIase active site. Cyp-3. S. cerevisiae Cpr1 interacts with the Rpd3 - Sin3 complex and in addition is a component of the Set3 complex. S. cerevisiae Cpr1 has also been shown to have a role in Zpr1p nuclear transport. Human cyclophilin H associates with the [U4/U6.U5] tri-snRNP particles of the splicesome. Length = 164
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
KOG0880217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 100.0
PTZ00060183 cyclophilin; Provisional 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 100.0
PTZ00221249 cyclophilin; Provisional 100.0
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
KOG0883518 consensus Cyclophilin type, U box-containing pepti 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 100.0
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
KOG0885 439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 100.0
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.47
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 96.67
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 96.58
PRK00969 508 hypothetical protein; Provisional 96.57
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 96.56
PRK00969508 hypothetical protein; Provisional 96.22
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 95.58
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 94.55
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 90.05
>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=5.3e-55  Score=342.39  Aligned_cols=190  Identities=67%  Similarity=1.070  Sum_probs=170.0

Q ss_pred             HHHHHHHHHHHHHHhcCCCcccccccccEEEEEEEECCEEeeEEEEEEeCCCCcchHHHHHHhhh-cCCCcccCCCcccc
Q 028464           12 LLWALVLFLTLAFIQEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCT-GEKGIGKSGKPLYY   90 (208)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~di~v~~t~~G~i~ieL~~~~aP~~~~nF~~l~~-g~~g~~~~~~~~~Y   90 (208)
                      ++++.++++....+.+.......|+++++|||||++.+...|||+|+||++.+|+||+||.+||. +.++.       .|
T Consensus        13 ~~~~~~~~~~~~~a~~~~~~~~~p~vT~kV~fdi~~g~~~~grIvigLfG~~vPKTV~NF~~l~~~~~~~~-------gY   85 (217)
T KOG0880|consen   13 LITARLFPVLNKGASSDKKYEPGPKVTHKVYFDIEIGGEPVGRIVIGLFGKVVPKTVENFRALATSGEKGY-------GY   85 (217)
T ss_pred             HhhhheeeeecceeccccccCCCCcceeEEEEEEEECCEeccEEEEEeccccchHHHHHHHHHHccCCCCc-------cc
Confidence            33333444443334443345677889999999999999999999999999999999999999998 55544       59


Q ss_pred             cCCEEEEecCCceEeecCCcCCCCCCCcccccccccccccccccCCCeEEEEeecCCCCCCceEEEEccCCCCCCCCCcE
Q 028464           91 KGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVV  170 (208)
Q Consensus        91 ~g~~f~rv~~~~~iq~G~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~G~l~~~~~~~~~~~sqF~Itl~~~~~ld~~~~v  170 (208)
                      .+++||||+|||+|||||...+++.++.++||++++||++.++|+++|.|||++.+|+++|||||||+...||||++|+|
T Consensus        86 ~gS~FhRVi~nfmIQGGd~t~g~gtGg~SIyG~~F~DENf~LkH~rpG~lSMAn~GpDtNGsQFfItT~~t~wLDGkhVV  165 (217)
T KOG0880|consen   86 KGSKFHRVIPNFMIQGGDFTKGDGTGGKSIYGEKFPDENFKLKHDRPGRLSMANAGPDTNGSQFFITTVKTPWLDGKHVV  165 (217)
T ss_pred             CCceeeeeecCceeecCccccCCCCCCeEeecCCCCCccceeecCCCceEeeeccCCCCCCceEEEEecCCccccCceeE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEcCHHHHHHHHhCCCC-CCCcccceEEEeeeeecC
Q 028464          171 FGKVLSGMDVVRKIEAEGRQ-SGEPKSKVVISNSGEMAL  208 (208)
Q Consensus       171 fG~Vi~G~~vl~~I~~~~~~-~~~P~~~i~I~~cg~l~~  208 (208)
                      ||+|++|||++.+|+...++ +++|.++++|.+||+|+.
T Consensus       166 FGqVl~Gmdvv~~Ie~~~TD~~dkP~e~v~I~~~g~l~~  204 (217)
T KOG0880|consen  166 FGQVLEGMDVVRKIENVKTDERDKPLEDVVIANCGELPV  204 (217)
T ss_pred             EeeehhhHHHHHHHHhcccCCCCCccccEEEeecCcccc
Confidence            99999999999999999764 689999999999999863

>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
1dyw_A173 Biochemical And Structural Characterization Of A Di 4e-60
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 3e-55
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 1e-54
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 6e-54
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 6e-54
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 7e-54
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 7e-54
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 4e-53
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 6e-52
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 1e-51
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 1e-51
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 2e-51
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 2e-51
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 2e-51
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 3e-51
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 3e-51
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 4e-51
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 1e-50
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 2e-49
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 2e-49
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 2e-49
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 2e-49
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 2e-49
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 2e-49
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 2e-49
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 3e-49
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 5e-49
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 6e-49
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 6e-49
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 6e-49
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 6e-49
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 7e-49
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 8e-49
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 1e-48
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 2e-48
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 3e-48
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 3e-48
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 4e-48
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 8e-48
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 1e-46
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 4e-46
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 5e-46
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 3e-45
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 3e-45
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 6e-45
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 4e-42
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 5e-42
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 6e-42
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 6e-41
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 7e-41
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 2e-40
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 8e-40
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 9e-39
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 6e-33
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 1e-25
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 1e-25
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 1e-25
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 2e-24
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 5e-22
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 2e-21
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 6e-21
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 2e-20
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 2e-20
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 5e-19
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 5e-16
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 3e-14
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 1e-13
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 3e-09
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 2e-08
1clh_A166 Three-Dimensional Solution Structure Of Escherichia 4e-08
1j2a_A166 Structure Of E. Coli Cyclophilin B K163t Mutant Len 5e-08
2ose_A234 Crystal Structure Of The Mimivirus Cyclophilin Leng 5e-07
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 5e-06
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 7e-06
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 1e-05
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure 
Iteration: 1

 Score =  227 bits (578), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 129/167 (77%)
Query: 40  KVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRII 99
           KV+FDI +GGK  GRIVM L+   VPKT  NFRALCTGE GIGKSGKPL++KGS FHRII
Sbjct: 5   KVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRII 64
Query: 100 PSFMIQXXXXXXXXXXXXESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTV 159
           P+FMIQ            ESI+GE F DENFK KHTGPGVLSMANAGP+TNGSQFF+ TV
Sbjct: 65  PNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTV 124
Query: 160 ITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEM 206
            T WLDG+HVVFG+V+ G+DVV+ +E+ G QSG+P    +I++ G++
Sbjct: 125 KTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKPVKDCMIADCGQL 171
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 Back     alignment and structure
>pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 Back     alignment and structure
>pdb|2OSE|A Chain A, Crystal Structure Of The Mimivirus Cyclophilin Length = 234 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 1e-124
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 1e-124
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 1e-123
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-123
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 1e-121
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 1e-121
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-121
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-120
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 1e-118
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 1e-117
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 1e-117
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 1e-116
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 1e-116
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 1e-116
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-116
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 1e-115
1z81_A229 Cyclophilin; structural genomics, structural genom 1e-115
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 1e-110
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 1e-109
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 3e-78
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 7e-77
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 9e-77
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 4e-76
2b71_A196 Cyclophilin-like protein; structural genomics, str 6e-73
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 4e-68
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 6e-68
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 7e-68
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 3e-66
2hq6_A185 Serologically defined colon cancer antigen 10; pro 1e-64
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 5e-63
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 5e-57
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 7e-44
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 9e-44
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 3e-42
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 9e-35
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
 Score =  349 bits (897), Expect = e-124
 Identities = 92/185 (49%), Positives = 124/185 (67%), Gaps = 2/185 (1%)

Query: 26  QEGNSREELEKVTHKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKS- 84
              +S   + + + + +FDIE+  +P+GRI+  LF    PKT +NF  LC+GEKG+GK+ 
Sbjct: 7   HHHHSSGLVPRGSPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTT 66

Query: 85  GKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMAN 144
           GK L YKGS+FHR++ +FMIQGGDF+ G+G+GGESI+G  F DENF LKH    +LSMAN
Sbjct: 67  GKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMAN 126

Query: 145 AGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGE-PKSKVVISNS 203
            G  TNGSQFFITT     LDG HVVFG V+SG +V+ +IE     +   P + V + + 
Sbjct: 127 RGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 186

Query: 204 GEMAL 208
           G +A 
Sbjct: 187 GVLAT 191
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
3kop_A188 Uncharacterized protein; protein with A cyclophili 96.36
2nnz_A153 Hypothetical protein; beta-barrel, structural geno 94.58
1zx8_A136 Hypothetical protein TM1367; structural genomics, 81.24
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
Probab=100.00  E-value=5.8e-55  Score=345.07  Aligned_cols=170  Identities=68%  Similarity=1.199  Sum_probs=162.7

Q ss_pred             ccEEEEEEEECCEEeeEEEEEEeCCCCcchHHHHHHhhhcCCCcccCCCcccccCCEEEEecCCceEeecCCcCCCCCCC
Q 028464           38 THKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGG  117 (208)
Q Consensus        38 ~~~v~~di~v~~t~~G~i~ieL~~~~aP~~~~nF~~l~~g~~g~~~~~~~~~Y~g~~f~rv~~~~~iq~G~~~~~~~~~~  117 (208)
                      +++||||+.++++++|+|+||||++.||++|+||++||++++|.++.++..||+|+.||||+|+|+|||||+..+++.++
T Consensus         3 ~~~v~~di~i~~~~~G~i~ieL~~~~aP~t~~NF~~L~~~~~g~g~~~~~~~Y~g~~FhRvi~~f~iQgGd~~~~~G~gg   82 (173)
T 2igv_A            3 RSKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGG   82 (173)
T ss_dssp             CCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHTTTCBCTTSSBSCCTTCBCCEEETTTEEEECCTTTSSSSCC
T ss_pred             CCEEEEEEEECCEecceEEEEEeCCCCcHHHHHHHHHhcCCCCCCccCccceECCCEEEEEECCCEEEcCCCCCCCCCCC
Confidence            68999999999999999999999999999999999999987776666777899999999999999999999987888999


Q ss_pred             cccccccccccccccccCCCeEEEEeecCCCCCCceEEEEccCCCCCCCCCcEEEEEEcCHHHHHHHHhCCCCCCCcccc
Q 028464          118 ESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSK  197 (208)
Q Consensus       118 ~~~~~~~~~~e~~~~~~~~~G~l~~~~~~~~~~~sqF~Itl~~~~~ld~~~~vfG~Vi~G~~vl~~I~~~~~~~~~P~~~  197 (208)
                      +++|++.+++|...++|+++|+|+|++.+|++++|||||++.+.|+||++|+|||+|++|||||++|++.++++++|.++
T Consensus        83 ~siyg~~f~dE~~~l~h~~~G~lsmAn~gp~tngSQFfIt~~~~~~LDg~~~vFG~Vv~G~dvv~~I~~~~t~~~~P~~~  162 (173)
T 2igv_A           83 ESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKPVKD  162 (173)
T ss_dssp             CBTTBSCBCCCCCCSCCCSTTEEEECCSSTTCBSSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTTCCTTSCCSSC
T ss_pred             CccCCCcccCcccccCCCCCeEEEEeeCCCCCcceEEEEEcCCccccCCCeeEEEEEecCHHHHHHHHhCCCCCCCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988999999


Q ss_pred             eEEEeeeeec
Q 028464          198 VVISNSGEMA  207 (208)
Q Consensus       198 i~I~~cg~l~  207 (208)
                      |+|.+||+|+
T Consensus       163 v~I~~~g~l~  172 (173)
T 2igv_A          163 CMIADCGQLK  172 (173)
T ss_dssp             EEEEEEEEEC
T ss_pred             EEEEEeEEEc
Confidence            9999999997
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} Back     alignment and structure
>2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} Back     alignment and structure
>1zx8_A Hypothetical protein TM1367; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: 1PE; 1.90A {Thermotoga maritima} SCOP: b.62.1.3 PDB: 2ka0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 208
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 1e-64
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 5e-63
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 2e-62
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 4e-61
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 1e-60
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 5e-57
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 5e-57
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 2e-55
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 1e-54
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 3e-54
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 3e-52
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 7e-52
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 4e-51
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 1e-44
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 4e-43
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 5e-39
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 3e-37
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 6e-33
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 2e-32
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 3e-30
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-28
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-24
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Caenorhabditis elegans, isoform 3 [TaxId: 6239]

 Score =  195 bits (497), Expect = 1e-64
 Identities = 116/167 (69%), Positives = 139/167 (83%)

Query: 40  KVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRII 99
           KV+FDI +GGK  GRIVM L+   VPKT  NFRALCTGE GIGKSGKPL++KGS FHRII
Sbjct: 5   KVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRII 64

Query: 100 PSFMIQGGDFTLGDGRGGESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTV 159
           P+FMIQGGDFT G+G GGESI+GE F DENFK KHTGPGVLSMANAGP+TNGSQFF+ TV
Sbjct: 65  PNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTV 124

Query: 160 ITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSKVVISNSGEM 206
            T WLDG+HVVFG+V+ G+DVV+ +E+ G QSG+P    +I++ G++
Sbjct: 125 KTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKPVKDCMIADCGQL 171
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1zx8a1124 Hypothetical protein TM1367 {Thermotoga maritima [ 86.39
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Caenorhabditis elegans, isoform 3 [TaxId: 6239]

Probab=100.00  E-value=3.1e-51  Score=322.03  Aligned_cols=170  Identities=68%  Similarity=1.199  Sum_probs=162.7

Q ss_pred             ccEEEEEEEECCEEeeEEEEEEeCCCCcchHHHHHHhhhcCCCcccCCCcccccCCEEEEecCCceEeecCCcCCCCCCC
Q 028464           38 THKVYFDIEVGGKPIGRIVMGLFGKAVPKTVENFRALCTGEKGIGKSGKPLYYKGSSFHRIIPSFMIQGGDFTLGDGRGG  117 (208)
Q Consensus        38 ~~~v~~di~v~~t~~G~i~ieL~~~~aP~~~~nF~~l~~g~~g~~~~~~~~~Y~g~~f~rv~~~~~iq~G~~~~~~~~~~  117 (208)
                      +++||||++++++++|+|+||||.+.||++|+||++||+++.+....++.++|+++.|||+++++++|+|++..+++.++
T Consensus         3 ~~~v~~Di~i~~~~~G~i~ieL~~~~aP~tv~nF~~L~~~~~~~~~~~k~~~y~~~~f~rv~~~~~i~~G~~~~~~~~~~   82 (172)
T d2igva1           3 RSKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGG   82 (172)
T ss_dssp             CCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHTTTCBCTTSSBSCCTTCBCCEEETTTEEEECCTTTSSSSCC
T ss_pred             CCEEEEEEEECCEeccEEEEEEcCCCCcHHHHHHHHHHhccccccccCcccccCCcceeEEEecceEEcCCccCCCCCCC
Confidence            58999999999999999999999999999999999999998887777888999999999999999999999988888888


Q ss_pred             cccccccccccccccccCCCeEEEEeecCCCCCCceEEEEccCCCCCCCCCcEEEEEEcCHHHHHHHHhCCCCCCCcccc
Q 028464          118 ESIFGESFADENFKLKHTGPGVLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGKVLSGMDVVRKIEAEGRQSGEPKSK  197 (208)
Q Consensus       118 ~~~~~~~~~~e~~~~~~~~~G~l~~~~~~~~~~~sqF~Itl~~~~~ld~~~~vfG~Vi~G~~vl~~I~~~~~~~~~P~~~  197 (208)
                      ...+++.+++|.....|+.+|+|+|++.++++++|||||+++++|+||++|+|||+|++|||||++|++.++++++|+++
T Consensus        83 ~~~~~~~~~~e~~~~~~~~~G~lsma~~~~~~~~sqFfIt~~~~~~ld~~~~vFG~Vv~Gmdvl~~I~~~~~~~g~P~~~  162 (172)
T d2igva1          83 ESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKPVKD  162 (172)
T ss_dssp             CBTTBSCBCCCCCCSCCCSTTEEEECCSSTTCBSSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTTCCTTSCCSSC
T ss_pred             cccCCCccCccccccccCCCcEEEEeecCCCCcCceeEeeecCCcccCCceeEEEEEeccHHHHHHHHcCCCCCCCCCCC
Confidence            88888899999888899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEeeeeec
Q 028464          198 VVISNSGEMA  207 (208)
Q Consensus       198 i~I~~cg~l~  207 (208)
                      |+|++||+|+
T Consensus       163 i~I~~cG~l~  172 (172)
T d2igva1         163 CMIADCGQLK  172 (172)
T ss_dssp             EEEEEEEEEC
T ss_pred             eEEEeccccC
Confidence            9999999996
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zx8a1 b.62.1.3 (A:1-124) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure