Citrus Sinensis ID: 028465

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21

MASADSSSNSNNDANDTETNPNPIPNPNSSKAIVAVPSASAAVCLMQFTGDAFAGAFMGSIFGYGAGLFKKKGLRGSFGEAGSHAKTFAVLSGVHSLVVCCLKRLRGKDDVINAGVAGCCTGIALSFPGEPSALLTSCISLGAFSFIMDGLNKQQPALAHSLSRQSRSGQFLVPRSLALPLPDELKDAFSSFCKSLRKPIKHGGRTAH

cccccccccccccccccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccc

********************************IVAVPSASAAVCLMQFTGDAFAGAFMGSIFGYGAGLFKKKGLRGSFGEAGSHAKTFAVLSGVHSLVVCCLKRLRGKDDVINAGVAGCCTGIALSFPGEPSALLTSCISLGAFSFIMDGLNK*******************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitochondrial import inner membrane translocase subunit TIM22-2	Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane.	probable	Q94EH2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!