Citrus Sinensis ID: 028477

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21

MEKSNNIGGAVAASSPLPMMGSRAHQEINEDGNAALRTAEPIARLVPMALCVAALVLMLKNSETSDFGSLSYSDLGAFRYLVHANGICAGYSLLSAIIAAMPRPSTMSQAWTFFFLDQLLTYLILAAGAVSTEVLYLERKGDLAITWSAVCGSFGGFCHKAIASVIITFVAVACYVVLSLISSYKLFSKYDAPIACSGKNIEVAAFHG

cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc

*************************************TAEPIARLVPMALCVAALVLMLKNSETSDFGSLSYSDLGAFRYLVHANGICAGYSLLSAIIAAMPRPSTMSQAWTFFFLDQLLTYLILAAGAVSTEVLYLERKGDLAITWSAVCGSFGGFCHKAIASVIITFVAVACYVVLSLISSYKLFSKYDAPIACSGKNIEVA****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
CASP-like protein VIT_01s0010g01870		confident	A7QBZ2
CASP-like protein At1g17200		probable	Q8VZQ3
CASP-like protein Os04g0281900		probable	Q0JEF7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted