Citrus Sinensis ID: 028500

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MKIEELDDVEHDRNDDGCRTTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLISPSQSRSISS
ccEEEccccccccccccccccHHHHHHHHHHHHcccccEEccHHHHHHHHHHHHHcccccccEEcccEEEccccccccHHHHHHccccEEEEcccccccccccccccccccCEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccc
******************RTTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLISPSQSRS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIEELDDVEHDRNDDGCRTTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLISPSQSRSISS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Protein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.probableQ66GT5
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Protein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.probableQ8WUK0
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Protein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.probableP0C089

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable
3.1.3.48Protein-tyrosine-phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PQ5, chain A
Confidence level:very confident
Coverage over the Query: 57-207
View the alignment between query and template
View the model in PyMOL