Citrus Sinensis ID: 028500

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MKIEELDDVEHDRNDDGCRTTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLISPSQSRSISS
ccEEEccccccccccccccccHHHHHHHHHHHHcccccEEccHHHHHHHHHHHHHcccccccEEcccEEEccccccccHHHHHHccccEEEEcccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccc
ccEEEcccccccccccccccEEEEEccHHHHHHHHHHHEEHcHHHHHHHHHHHcccccccHHcccccEEEcccccccHHHHHHHccccEEEEEcccccccccHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHccccHHHHHHHHHHccccEEccHHHHHHHHHHHHHcccc
mkieelddvehdrnddgcrtTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLlgavpfpkdvprlkqlgvggvitlnepyetlvpsslyhahgidhlviptrdylfapsfvDIRRAVdfihsnscagkttyvhckagrgrsTTIVLCYLVEYKHMAPAAALEYVrcrrprvllapsqwklispsqsrsiss
mkieelddvehdrnddgcrtTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAvpfpkdvprLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIhsnscagkttyvhckagrgrSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLlapsqwklispsqsrsiss
MKIEELDDVEHDRNDDGCRTTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLIspsqsrsiss
******************RTTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLI**********
*********************************GAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLISPSQSRS***
***************DGCRTTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWK************
*******DVEH*****GCRTTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLISPSQSRS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIEELDDVEHDRNDDGCRTTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLISPSQSRSISS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query208 2.2.26 [Sep-21-2011]
Q9ZQP1 337 Putative dual specificity no no 0.951 0.587 0.625 9e-73
Q66GT5193 Phosphatidylglycerophosph yes no 0.822 0.886 0.376 3e-25
P0C089193 Phosphatidylglycerophosph yes no 0.822 0.886 0.382 7e-25
Q8WUK0201 Phosphatidylglycerophosph yes no 0.802 0.830 0.379 4e-23
Q86BN8200 Phosphatidylglycerophosph yes no 0.759 0.79 0.359 7e-22
Q9ZR37198 Dual specificity protein no no 0.600 0.631 0.313 2e-07
Q5R6H6211 Dual specificity protein no no 0.576 0.568 0.320 6e-07
Q9BV47211 Dual specificity protein no no 0.576 0.568 0.320 7e-07
Q5FVI9211 Dual specificity protein no no 0.576 0.568 0.328 8e-07
Q5RD73185 Dual specificity protein no no 0.591 0.664 0.302 1e-06
>sp|Q9ZQP1|DSP8_ARATH Putative dual specificity protein phosphatase DSP8 OS=Arabidopsis thaliana GN=DSP8 PE=2 SV=2 Back     alignment and function desciption
 Score =  272 bits (696), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 132/211 (62%), Positives = 160/211 (75%), Gaps = 13/211 (6%)

Query: 1   MKIEELDDVEHDRN--------DDGCRTTQIVKAD-----AKRALVGAGARILFYPTLLY 47
           M I+EL + + ++         DDG +   + + +      KRALVG GAR LFYPTL+Y
Sbjct: 1   MYIKELTETDEEKRERSVEDNVDDGDKAVLVSRGNVIVLTTKRALVGVGARALFYPTLVY 60

Query: 48  NVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYH 107
           NV RNK+++EFRWWD V +F+LLGAVPFP DVP+LK+LGV GVITLNEPYETLVPSSLY 
Sbjct: 61  NVVRNKLESEFRWWDRVAEFILLGAVPFPSDVPQLKELGVCGVITLNEPYETLVPSSLYK 120

Query: 108 AHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLV 167
           ++ IDHLVI TRDY FAPS   I +AV+FIH N+  GKTTYVHCKAGRGRSTTIV+CYLV
Sbjct: 121 SYCIDHLVIATRDYCFAPSMEAICQAVEFIHRNASLGKTTYVHCKAGRGRSTTIVICYLV 180

Query: 168 EYKHMAPAAALEYVRCRRPRVLLAPSQWKLI 198
           ++K+M P AA  YVR  RPRVLLA +QWK +
Sbjct: 181 QHKNMTPEAAYSYVRSIRPRVLLAAAQWKAV 211
May possess phosphatase activity.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q66GT5|PTPM1_MOUSE Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Mus musculus GN=Ptpmt1 PE=1 SV=1 Back     alignment and function description
>sp|P0C089|PTPM1_RAT Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Rattus norvegicus GN=Ptpmt1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WUK0|PTPM1_HUMAN Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Homo sapiens GN=PTPMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q86BN8|PTPM1_DROME Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Drosophila melanogaster GN=Plip PE=2 SV=1 Back     alignment and function description
>sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 Back     alignment and function description
>sp|Q5R6H6|DUS26_PONAB Dual specificity protein phosphatase 26 OS=Pongo abelii GN=DUSP26 PE=2 SV=1 Back     alignment and function description
>sp|Q9BV47|DUS26_HUMAN Dual specificity protein phosphatase 26 OS=Homo sapiens GN=DUSP26 PE=1 SV=1 Back     alignment and function description
>sp|Q5FVI9|DUS26_RAT Dual specificity protein phosphatase 26 OS=Rattus norvegicus GN=Dusp26 PE=2 SV=1 Back     alignment and function description
>sp|Q5RD73|DUS3_PONAB Dual specificity protein phosphatase 3 OS=Pongo abelii GN=DUSP3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
359484523280 PREDICTED: protein-tyrosine phosphatase 0.995 0.739 0.836 5e-98
356523809282 PREDICTED: protein-tyrosine phosphatase 0.995 0.734 0.816 4e-95
255546267284 Protein-tyrosine phosphatase mitochondri 0.980 0.718 0.825 1e-94
357520799 309 Protein-tyrosine phosphatase mitochondri 0.951 0.640 0.833 7e-94
388506428 309 unknown [Medicago truncatula] 0.951 0.640 0.833 8e-94
449446548285 PREDICTED: putative dual specificity pro 0.985 0.719 0.785 9e-92
363807856252 uncharacterized protein LOC100786889 [Gl 0.913 0.753 0.831 2e-88
147780311271 hypothetical protein VITISV_033771 [Viti 0.855 0.656 0.802 1e-86
102139981 469 dual specificity protein phosphatase fam 0.971 0.430 0.697 4e-82
224137180 319 predicted protein [Populus trichocarpa] 0.932 0.608 0.737 5e-81
>gi|359484523|ref|XP_002283341.2| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like isoform 1 [Vitis vinifera] gi|297738731|emb|CBI27976.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 174/208 (83%), Positives = 185/208 (88%), Gaps = 1/208 (0%)

Query: 1   MKIEELDDVEHDRNDDGCRTTQIVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRW 60
           MKIE+LDDVE D  +   R  Q+VK DAK ALVGAGARILFYPTLLYNVFRNKIQAEFRW
Sbjct: 1   MKIEDLDDVESDGKESVYRR-QVVKVDAKMALVGAGARILFYPTLLYNVFRNKIQAEFRW 59

Query: 61  WDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRD 120
           WDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVP+SLYHAH IDHLVIPTRD
Sbjct: 60  WDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPTSLYHAHEIDHLVIPTRD 119

Query: 121 YLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEY 180
           YLFAPSFVDI RAVDFIH N+ +G+TTYVHCKAGRGRSTTIVLCYLVEYKHM PAAALEY
Sbjct: 120 YLFAPSFVDISRAVDFIHKNASSGRTTYVHCKAGRGRSTTIVLCYLVEYKHMTPAAALEY 179

Query: 181 VRCRRPRVLLAPSQWKLISPSQSRSISS 208
           VR RRPRVLLAPSQWK +     R +++
Sbjct: 180 VRSRRPRVLLAPSQWKAVQEYNKRQLAT 207

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356523809|ref|XP_003530527.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255546267|ref|XP_002514193.1| Protein-tyrosine phosphatase mitochondrial 1, mitochondrial precursor, putative [Ricinus communis] gi|223546649|gb|EEF48147.1| Protein-tyrosine phosphatase mitochondrial 1, mitochondrial precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357520799|ref|XP_003630688.1| Protein-tyrosine phosphatase mitochondrial [Medicago truncatula] gi|355524710|gb|AET05164.1| Protein-tyrosine phosphatase mitochondrial [Medicago truncatula] Back     alignment and taxonomy information
>gi|388506428|gb|AFK41280.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449446548|ref|XP_004141033.1| PREDICTED: putative dual specificity protein phosphatase DSP8-like [Cucumis sativus] gi|449487987|ref|XP_004157900.1| PREDICTED: putative dual specificity protein phosphatase DSP8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|363807856|ref|NP_001242698.1| uncharacterized protein LOC100786889 [Glycine max] gi|255640082|gb|ACU20332.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|147780311|emb|CAN61438.1| hypothetical protein VITISV_033771 [Vitis vinifera] Back     alignment and taxonomy information
>gi|102139981|gb|ABF70116.1| dual specificity protein phosphatase family protein [Musa balbisiana] Back     alignment and taxonomy information
>gi|224137180|ref|XP_002327058.1| predicted protein [Populus trichocarpa] gi|222835373|gb|EEE73808.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
UNIPROTKB|Q5JNL3 341 P0638D12.17 "Putative PTEN-lik 0.846 0.516 0.744 8.6e-72
UNIPROTKB|Q0DGM1 377 Os05g0524200 "Os05g0524200 pro 0.875 0.482 0.708 1.4e-69
TAIR|locus:2165016228 AT5G56610 "AT5G56610" [Arabido 0.932 0.850 0.688 4.9e-69
TAIR|locus:2058699 337 AT2G35680 "AT2G35680" [Arabido 0.947 0.584 0.632 2.8e-66
UNIPROTKB|Q7XC53 362 OSJNBb0089A17.7 "Putative unch 0.822 0.472 0.701 2e-63
UNIPROTKB|Q0DEH7115 Os06g0152000 "Os06g0152000 pro 0.403 0.730 0.797 4.7e-32
UNIPROTKB|Q2NKZ7270 PTPMT1 "Uncharacterized protei 0.822 0.633 0.387 4e-26
WB|WBGene00009207189 F28C6.8 [Caenorhabditis elegan 0.769 0.846 0.359 1.1e-25
UNIPROTKB|I2HA91189 F28C6.8 "Protein F28C6.8, isof 0.769 0.846 0.359 1.1e-25
MGI|MGI:1913711193 Ptpmt1 "protein tyrosine phosp 0.822 0.886 0.376 1.8e-25
UNIPROTKB|Q5JNL3 P0638D12.17 "Putative PTEN-like phosphatase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 726 (260.6 bits), Expect = 8.6e-72, P = 8.6e-72
 Identities = 131/176 (74%), Positives = 153/176 (86%)

Query:    23 IVKADAKRALVGAGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFPKDVPRL 82
             + +  AKRALVGAGAR+LFYPTLLYNV RN+ +AEFRWWD VDQ++LLGAVPFP DVPRL
Sbjct:    35 VARLSAKRALVGAGARVLFYPTLLYNVLRNRFEAEFRWWDRVDQYILLGAVPFPSDVPRL 94

Query:    83 KQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHSNSC 142
             KQLGV GV+TLNE YETLVP+SLY AHGIDHL+IPTRDYLFAP+  DI +A+DFIH N+ 
Sbjct:    95 KQLGVQGVVTLNEAYETLVPTSLYQAHGIDHLIIPTRDYLFAPALQDICQAIDFIHRNAS 154

Query:   143 AGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLI 198
              G  TYVHCKAGRGRSTTIVLCYL++Y+ M+P AAL++VR  RPRVLLAPSQW+ +
Sbjct:   155 EGGITYVHCKAGRGRSTTIVLCYLIKYRSMSPEAALDHVRSIRPRVLLAPSQWQAV 210
GO:0004439 "phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity" evidence=IBA
GO:0006470 "protein dephosphorylation" evidence=IBA
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IBA
GO:0046855 "inositol phosphate dephosphorylation" evidence=IBA
UNIPROTKB|Q0DGM1 Os05g0524200 "Os05g0524200 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2165016 AT5G56610 "AT5G56610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058699 AT2G35680 "AT2G35680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XC53 OSJNBb0089A17.7 "Putative uncharacterized protein OSJNBb0089A17.7" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q0DEH7 Os06g0152000 "Os06g0152000 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q2NKZ7 PTPMT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00009207 F28C6.8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|I2HA91 F28C6.8 "Protein F28C6.8, isoform b" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:1913711 Ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q66GT5PTPM1_MOUSE3, ., 1, ., 3, ., 4, 80.37640.82210.8860yesno
P0C089PTPM1_RAT3, ., 1, ., 3, ., 4, 80.38200.82210.8860yesno
Q8WUK0PTPM1_HUMAN3, ., 1, ., 3, ., 4, 80.37930.80280.8308yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.824
3rd Layer3.1.30.766
3rd Layer3.1.3.480.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 3e-17
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 2e-15
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 7e-15
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 1e-14
PRK12361 547 PRK12361, PRK12361, hypothetical protein; Provisio 2e-14
PTZ00242166 PTZ00242, PTZ00242, protein tyrosine phosphatase; 6e-06
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information 
 Score = 74.2 bits (183), Expect = 3e-17
 Identities = 39/126 (30%), Positives = 59/126 (46%), Gaps = 4/126 (3%)

Query: 63  EVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYL 122
           E+   L LG+ P   D   LK+LG+  V+ + +     VP+        ++L +P  D  
Sbjct: 4   EITPGLYLGSYPAASDKELLKKLGITHVLNVAKE----VPNENLFLSDFNYLYVPILDLP 59

Query: 123 FAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVR 182
                     AVDFI      G    VHC AG  RS T+V+ YL++   ++   A E+V+
Sbjct: 60  SQDISKYFDEAVDFIDDAREKGGKVLVHCLAGVSRSATLVIAYLMKTLGLSLREAYEFVK 119

Query: 183 CRRPRV 188
            RRP +
Sbjct: 120 SRRPII 125

Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185524 PTZ00242, PTZ00242, protein tyrosine phosphatase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
KOG1719183 consensus Dual specificity phosphatase [Defense me 100.0
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 100.0
PRK12361 547 hypothetical protein; Provisional 100.0
KOG1718198 consensus Dual specificity phosphatase [Defense me 100.0
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 100.0
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 99.98
KOG1717343 consensus Dual specificity phosphatase [Defense me 99.97
KOG1716285 consensus Dual specificity phosphatase [Defense me 99.96
PTZ00242166 protein tyrosine phosphatase; Provisional 99.96
PTZ00393241 protein tyrosine phosphatase; Provisional 99.95
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.92
KOG1720225 consensus Protein tyrosine phosphatase CDC14 [Defe 99.9
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 99.84
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.79
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 99.74
KOG2836173 consensus Protein tyrosine phosphatase IVA1 [Signa 99.72
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 99.63
PLN02727 986 NAD kinase 99.56
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.55
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.55
KOG1572249 consensus Predicted protein tyrosine phosphatase [ 99.51
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 99.44
COG3453130 Uncharacterized protein conserved in bacteria [Fun 99.44
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 99.42
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 99.38
PHA02747312 protein tyrosine phosphatase; Provisional 99.32
PHA02740298 protein tyrosine phosphatase; Provisional 99.32
PHA02742303 protein tyrosine phosphatase; Provisional 99.3
PHA02738320 hypothetical protein; Provisional 99.27
PHA02746323 protein tyrosine phosphatase; Provisional 99.26
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 99.23
KOG2283 434 consensus Clathrin coat dissociation kinase GAK/PT 99.19
KOG0790600 consensus Protein tyrosine phosphatase Corkscrew a 99.1
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 99.08
KOG07921144 consensus Protein tyrosine phosphatase PTPMEG, con 99.07
COG5350172 Predicted protein tyrosine phosphatase [General fu 99.04
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 99.01
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 98.95
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 98.85
KOG2386 393 consensus mRNA capping enzyme, guanylyltransferase 98.76
KOG0791374 consensus Protein tyrosine phosphatase, contains f 98.68
KOG0789415 consensus Protein tyrosine phosphatase [Signal tra 98.44
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 98.38
KOG4228 1087 consensus Protein tyrosine phosphatase [Signal tra 98.28
KOG42281087 consensus Protein tyrosine phosphatase [Signal tra 98.28
KOG07931004 consensus Protein tyrosine phosphatase [Signal tra 98.27
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 96.79
KOG4471 717 consensus Phosphatidylinositol 3-phosphate 3-phosp 94.13
PLN02160136 thiosulfate sulfurtransferase 92.54
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 92.44
PRK01415247 hypothetical protein; Validated 92.39
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 91.77
KOG1089 573 consensus Myotubularin-related phosphatidylinosito 91.76
PF06602353 Myotub-related: Myotubularin-like phosphatase doma 91.33
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 89.03
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 86.72
COG1054308 Predicted sulfurtransferase [General function pred 84.44
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 80.72
PF04343122 DUF488: Protein of unknown function, DUF488; Inter 80.1
>KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-42  Score=251.79  Aligned_cols=170  Identities=58%  Similarity=1.025  Sum_probs=161.8

Q ss_pred             hccceeecchhhHHHHHHhhhccCCCcccccCceEEcCCCCC-CChhHHHhCCCcEEEEecCCCccCCCccchhcCCcEE
Q 028500           35 AGARILFYPTLLYNVFRNKIQAEFRWWDEVDQFLLLGAVPFP-KDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDH  113 (208)
Q Consensus        35 ~~~~~~~~P~~~~~~~~~~~~~~~~~~~~I~~~l~lG~~~~~-~~~~~L~~~gI~~Vi~l~~~~~~~~~~~~~~~~gi~~  113 (208)
                      +++|++|||||+||++|.+ ...++|| ++++++.+|..|.. .+.+.++++|+..||.|++++|...+...|+..|+++
T Consensus         1 ~~ar~~fyptllynvv~~k-~s~~~wy-~~~~~v~~~~~~FrS~~~~~i~ke~v~gvv~~ne~yE~~a~s~~wk~~giE~   78 (183)
T KOG1719|consen    1 MGARVLFYPTLLYNVVREK-ASAFRWY-RIDEFVILGAMPFRSMDVPLIKKENVGGVVTLNEPYELLAPSNLWKNYGIEF   78 (183)
T ss_pred             CCceeeecHHHHHHHHHHH-Hhhhcee-eecceEEEeecccccccchHHHhcCCCeEEEeCCchhhhhhhHHHHhcccee
Confidence            4799999999999999999 6789999 99999999999987 6778889999999999999999988888999999999


Q ss_pred             EEEeCCCCCCCCcHHHHHHHHHHHHHHhhCCCcEEEEcCCCCCchHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCccCHH
Q 028500          114 LVIPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPS  193 (208)
Q Consensus       114 ~~ip~~D~~~~~~~~~~~~~~~~i~~~~~~~~~VlVHC~~G~~RS~~v~~ayL~~~~~~s~~~A~~~vr~~Rp~~~~~~~  193 (208)
                      +.+|+.|....|+.+.+.++++||++....|+.|||||++|++||+|+++||||+..+|++++|++++|++||.+.+.++
T Consensus        79 L~i~T~D~~~~Ps~~~i~~aVeFi~k~asLGktvYVHCKAGRtRSaTvV~cYLmq~~~wtpe~A~~~vr~iRp~VlL~~~  158 (183)
T KOG1719|consen   79 LVIPTRDYTGAPSLENIQKAVEFIHKNASLGKTVYVHCKAGRTRSATVVACYLMQHKNWTPEAAVEHVRKIRPRVLLRPA  158 (183)
T ss_pred             EEeccccccCCCCHHHHHHHHHHHHhccccCCeEEEEecCCCccchhhhhhhhhhhcCCCHHHHHHHHHhcCcceeecHH
Confidence            99999999889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhc
Q 028500          194 QWKLISPSQSRSI  206 (208)
Q Consensus       194 ~~~~L~~~~~~l~  206 (208)
                      |++.|.+|.+.+.
T Consensus       159 Qw~~l~ef~~~~~  171 (183)
T KOG1719|consen  159 QWDVLKEFYKQIV  171 (183)
T ss_pred             HHHHHHHHHHHHH
Confidence            9999999998764

>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] Back     alignment and domain information
>KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1089 consensus Myotubularin-related phosphatidylinositol 3-phosphate 3-phosphatase MTM6 [General function prediction only] Back     alignment and domain information
>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>PF04343 DUF488: Protein of unknown function, DUF488; InterPro: IPR007438 This family includes several proteins of uncharacterised function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
3rgo_A157 Crystal Structure Of Ptpmt1 Length = 157 5e-19
3rgq_A156 Crystal Structure Of Ptpmt1 In Complex With Pi(5)p 6e-18
2e0t_A151 Crystal Structure Of Catalytic Domain Of Dual Speci 7e-08
3f81_A183 Interaction Of Vhr With Sa3 Length = 183 1e-07
1vhr_A184 Human Vh1-Related Dual-Specificity Phosphatase Leng 1e-07
4hrf_A160 Atomic Structure Of Dusp26 Length = 160 6e-07
1j4x_A184 Human Vh1-Related Dual-Specificity Phosphatase C124 1e-06
1ohc_A348 Structure Of The Proline Directed Phosphatase Cdc14 2e-06
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 1e-05
1zzw_A149 Crystal Structure Of Catalytic Domain Of Human Map 1e-05
1yz4_A160 Crystal Structure Of Dusp15 Length = 160 1e-05
2oud_A177 Crystal Structure Of The Catalytic Domain Of Human 2e-05
4erc_A150 Structure Of Vhz Bound To Metavanadate Length = 150 2e-05
1ohe_A348 Structure Of Cdc14b Phosphatase With A Peptide Liga 2e-05
1m3g_A145 Solution Structure Of The Catalytic Domain Of Mapk 4e-05
1wrm_A165 Crystal Structure Of Jsp-1 Length = 165 4e-05
2img_A151 Crystal Structure Of Dual Specificity Protein Phosp 4e-05
2y96_A219 Structure Of Human Dual-Specificity Phosphatase 27 1e-04
2pq5_A205 Crystal Structure Of Dual Specificity Protein Phosp 2e-04
2g6z_A211 Crystal Structure Of Human Dusp5 Length = 211 6e-04
>pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 Back     alignment and structure 
Iteration: 1

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 75/143 (52%), Gaps = 4/143 (2%)
Query: 60  WWDEVDQFLLLGAVPFPKDVPRLK-QLGVGGVITLNEPYETLV---PSSLYHAHGIDHLV 115
           W+  +D  +LLGA+P      RL     V GVIT+NE YET      S  +   G++ L 
Sbjct: 1   WYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLR 60
Query: 116 IPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPA 175
           + T D    P+  ++ + V F       G+  YVHCKAGR RS T+V  YL++  + +P 
Sbjct: 61  LSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPE 120
Query: 176 AALEYVRCRRPRVLLAPSQWKLI 198
            A+E +   R  + + PSQ +++
Sbjct: 121 EAIEAIAKIRSHISIRPSQLEVL 143
>pdb|3RGQ|A Chain A, Crystal Structure Of Ptpmt1 In Complex With Pi(5)p Length = 156 Back     alignment and structure
>pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 Back     alignment and structure
>pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 Back     alignment and structure
>pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 Back     alignment and structure
>pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 Back     alignment and structure
>pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 Back     alignment and structure
>pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14 Length = 348 Back     alignment and structure
>pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure
>pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 Back     alignment and structure
>pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 Back     alignment and structure
>pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 Back     alignment and structure
>pdb|4ERC|A Chain A, Structure Of Vhz Bound To Metavanadate Length = 150 Back     alignment and structure
>pdb|1OHE|A Chain A, Structure Of Cdc14b Phosphatase With A Peptide Ligand Length = 348 Back     alignment and structure
>pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 Back     alignment and structure
>pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 Back     alignment and structure
>pdb|2IMG|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 23 From Homo Sapiens In Complex With Ligand Malate Ion Length = 151 Back     alignment and structure
>pdb|2Y96|A Chain A, Structure Of Human Dual-Specificity Phosphatase 27 Length = 219 Back     alignment and structure
>pdb|2PQ5|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 13 (Dusp13) Length = 205 Back     alignment and structure
>pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 1e-50
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 4e-42
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 9e-34
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 2e-30
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 2e-28
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 9e-27
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 1e-26
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 6e-25
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 1e-23
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 1e-22
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 3e-22
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 6e-22
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 8e-22
2hxp_A155 Dual specificity protein phosphatase 9; human phos 2e-21
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 4e-21
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 4e-21
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 5e-21
2oud_A177 Dual specificity protein phosphatase 10; A central 6e-21
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 9e-21
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 1e-20
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 2e-20
2hcm_A164 Dual specificity protein phosphatase; structural g 2e-20
3emu_A161 Leucine rich repeat and phosphatase domain contain 8e-20
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 1e-19
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 2e-19
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 2e-19
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 1e-18
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 1e-17
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 2e-17
2q05_A195 Late protein H1, dual specificity protein phosphat 3e-16
3cm3_A176 Late protein H1, dual specificity protein phosphat 4e-16
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 1e-14
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 2e-12
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 2e-10
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 2e-10
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 6e-10
1xri_A151 AT1G05000; structural genomics, protein structure 5e-09
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 1e-08
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 1e-08
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 2e-08
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
 Score =  160 bits (407), Expect = 1e-50
 Identities = 49/141 (34%), Positives = 73/141 (51%), Gaps = 4/141 (2%)

Query: 60  WWDEVDQFLLLGAVPFPKDVPRLKQ-LGVGGVITLNEPYETLV---PSSLYHAHGIDHLV 115
           W+  +D  +LLGA+P      RL     V GVIT+NE YET      S  +   G++ L 
Sbjct: 1   WYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLR 60

Query: 116 IPTRDYLFAPSFVDIRRAVDFIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPA 175
           + T D    P+  ++ + V F       G+  YVHCKAGR RS T+V  YL++  + +P 
Sbjct: 61  LSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPE 120

Query: 176 AALEYVRCRRPRVLLAPSQWK 196
            A+E +   R  + + PSQ +
Sbjct: 121 EAIEAIAKIRSHISIRPSQLE 141
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 100.0
3emu_A161 Leucine rich repeat and phosphatase domain contain 100.0
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 100.0
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 100.0
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 100.0
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 100.0
2hxp_A155 Dual specificity protein phosphatase 9; human phos 100.0
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 100.0
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 100.0
2oud_A177 Dual specificity protein phosphatase 10; A central 100.0
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 100.0
2hcm_A164 Dual specificity protein phosphatase; structural g 100.0
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 100.0
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 100.0
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 100.0
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 100.0
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 100.0
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 100.0
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 100.0
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 100.0
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.98
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.97
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.97
2q05_A195 Late protein H1, dual specificity protein phosphat 99.97
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.96
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.95
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.95
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.93
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.93
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.93
1xri_A151 AT1G05000; structural genomics, protein structure 99.93
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.92
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.92
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.9
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.84
2f46_A156 Hypothetical protein; structural genomics, joint c 99.84
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.81
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 99.77
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.75
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 99.52
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 99.51
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 99.47
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.45
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 99.44
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 99.44
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 99.43
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 99.42
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 99.42
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 99.41
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 99.4
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 99.4
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 99.39
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 99.39
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 99.39
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 99.39
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 99.39
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 99.39
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 99.37
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 99.37
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 99.37
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 99.36
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 99.36
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 99.35
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 99.33
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 99.33
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.32
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 99.32
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 99.32
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 99.31
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 99.31
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 99.31
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 99.28
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.27
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.25
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 99.24
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.23
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 99.2
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 99.19
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 99.15
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 99.14
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.1
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 99.07
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 99.01
1ohe_A 348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 97.75
2yf0_A 512 Myotubularin-related protein 6; hydrolase; 2.65A { 91.24
1zsq_A 528 Myotubularin-related protein 2; protein-phospholip 91.16
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 89.87
1vee_A134 Proline-rich protein family; hypothetical protein, 83.0
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 81.44
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
Probab=100.00  E-value=2e-36  Score=228.19  Aligned_cols=149  Identities=33%  Similarity=0.596  Sum_probs=135.5

Q ss_pred             CcccccCceEEcCCCCCCChhHH-HhCCCcEEEEecCCCccCC---CccchhcCCcEEEEEeCCCCCCCCcHHHHHHHHH
Q 028500           60 WWDEVDQFLLLGAVPFPKDVPRL-KQLGVGGVITLNEPYETLV---PSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVD  135 (208)
Q Consensus        60 ~~~~I~~~l~lG~~~~~~~~~~L-~~~gI~~Vi~l~~~~~~~~---~~~~~~~~gi~~~~ip~~D~~~~~~~~~~~~~~~  135 (208)
                      ||++|+|+||+|++|.+.+...+ +++||++||||+.+.+...   +...+...|++|+++|+.|....|..+.+.++++
T Consensus         1 wf~~I~~~l~~g~~~~~~~~~~ll~~~gi~~Vi~l~~~~e~~~~~~~~~~~~~~gi~~~~~p~~d~~~~~~~~~~~~~~~   80 (157)
T 3rgo_A            1 WYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQ   80 (157)
T ss_dssp             CEEECSSSEEEESCCCGGGHHHHHHHSCEEEEEEESCCTTTTTSSCCHHHHHHTTCEEEEECCCTTTSSCCHHHHHHHHH
T ss_pred             CcccccCCeEEecCcCccchHHHHHHcCCCEEEECccccccccccCCHHHHHHCCCeEEEecCCCCCCCChHHHHHHHHH
Confidence            89999999999999998877666 8999999999998765421   2345667899999999999866888999999999


Q ss_pred             HHHHHhhCCCcEEEEcCCCCCchHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCccCHHHHHHHHHHHHhhccC
Q 028500          136 FIHSNSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLISPSQSRSISS  208 (208)
Q Consensus       136 ~i~~~~~~~~~VlVHC~~G~~RS~~v~~ayL~~~~~~s~~~A~~~vr~~Rp~~~~~~~~~~~L~~~~~~l~~s  208 (208)
                      +|++..+.|++|||||.+|+||||+++++|||...|+++++|++.+|++||.+.+|++|+++|.+|++.+.+|
T Consensus        81 ~i~~~~~~~~~vlVHC~~G~~Rsg~~~~a~l~~~~~~~~~~a~~~v~~~R~~~~~~~~~~~~L~~~~~~l~~~  153 (157)
T 3rgo_A           81 FALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLKEFHKEITAR  153 (157)
T ss_dssp             HHHHHHHTTCEEEEESSSSSSHHHHHHHHHHHHHHTCCHHHHHHHHHHHSTTCCCCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCEEEEECCCCCChHHHHHHHHHHHHcCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHhh
Confidence            9999999999999999999999999999999999999999999999999999999999999999999998653
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 208
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 5e-23
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 1e-19
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 2e-19
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 2e-19
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 2e-18
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 5e-18
d1xria_151 c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal 2e-12
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 7e-11
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 2e-09
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 1e-08
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: VH1-related dual-specificity phosphatase, VHR
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 89.1 bits (220), Expect = 5e-23
 Identities = 37/130 (28%), Positives = 57/130 (43%), Gaps = 4/130 (3%)

Query: 61  WDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETL---VPSSLYHAHGIDHLVIP 117
            +EV   + +G     +D+P+L++LG+  V+   E    +     ++ Y   GI +L I 
Sbjct: 23  CNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIK 82

Query: 118 TRDYLFAPSFVDIRRAVDFIHSNSCAGK-TTYVHCKAGRGRSTTIVLCYLVEYKHMAPAA 176
             D           RA DFI            VHC+ G  RS T+V+ YL+  + M   +
Sbjct: 83  ANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKS 142

Query: 177 ALEYVRCRRP 186
           AL  VR  R 
Sbjct: 143 ALSIVRQNRE 152
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 100.0
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 100.0
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 100.0
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.96
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.95
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.92
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.92
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.88
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.86
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.38
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.34
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 99.24
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 99.22
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 99.22
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 99.21
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 99.18
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 99.17
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 99.16
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 99.15
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 99.15
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 99.15
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 99.05
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 97.08
d1zsqa2 387 Myotubularin-related protein 2, C-terminal domain 92.32
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 87.84
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 84.21
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

Probab=100.00  E-value=5.4e-37  Score=227.23  Aligned_cols=142  Identities=18%  Similarity=0.222  Sum_probs=131.5

Q ss_pred             CcccccCceEEcCCCCCCChhHHHhCCCcEEEEecCCCccCCCccchhcCCcEEEEEeCCCCCCCCcHHHHHHHHHHHHH
Q 028500           60 WWDEVDQFLLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYHAHGIDHLVIPTRDYLFAPSFVDIRRAVDFIHS  139 (208)
Q Consensus        60 ~~~~I~~~l~lG~~~~~~~~~~L~~~gI~~Vi~l~~~~~~~~~~~~~~~~gi~~~~ip~~D~~~~~~~~~~~~~~~~i~~  139 (208)
                      ++++|.|+||+|+...+.+.+.|+++||++|||++.+.    +.......++.|+++|+.|.+..+..+.|+++++||++
T Consensus         3 ~P~eI~p~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~----~~~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~   78 (144)
T d1mkpa_           3 FPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNL----PNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDE   78 (144)
T ss_dssp             CCEEEETTEEEECTTSCCCHHHHHHTTEEEEEECCSSC----CCEEEEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHH
T ss_pred             CCCeEECCEEECChhHhcCHHHHHhCCCcEEEEccccC----CccccCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHH
Confidence            56899999999999999999999999999999998753    33345568899999999998777788899999999999


Q ss_pred             HhhCCCcEEEEcCCCCCchHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCccCHHHHHHHHHHHHhh
Q 028500          140 NSCAGKTTYVHCKAGRGRSTTIVLCYLVEYKHMAPAAALEYVRCRRPRVLLAPSQWKLISPSQSRS  205 (208)
Q Consensus       140 ~~~~~~~VlVHC~~G~~RS~~v~~ayL~~~~~~s~~~A~~~vr~~Rp~~~~~~~~~~~L~~~~~~l  205 (208)
                      .+++|++|||||.+|+|||+++++||||+..|+|+.+|+++++++||.+.||.+|+++|.+|++.|
T Consensus        79 ~~~~~~~VlVHC~~G~~RS~~vv~aYLm~~~~~~~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L  144 (144)
T d1mkpa_          79 ARGKNCGVLVHSLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL  144 (144)
T ss_dssp             HHHTTCEEEEECSSCSHHHHHHHHHHHHHHHTCCHHHHHHHHHHHCTTCCCCSTTHHHHHHHHHTC
T ss_pred             hhhccceEEEEecccccchHHHHHHHHHHHhCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHhhC
Confidence            999999999999999999999999999999999999999999999999999999999999999875
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure