Citrus Sinensis ID: 028523


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MPGMTAYAGFFEVCSPKQGEYVFVSAASGAVGQLVGQFAKLVGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEPDLDAALKRYFPEGINIYFENVGGKMLDAVLLNMRIQGRITLCGMISQYNNDKPEGVHNLTCLISKRIRMEGFLVPDYFHLYPKFLEMMIPRIKEGKIVYVEDKAEGLESAPAALVGLFSGRNVGKQVVEVATE
ccccHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHccccEEEcccccccHHHHHHHHcccccEEEEcccccHHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHccEEEEEEEEccccccHHHHHHHHHHHHHccccEEEEEHHHHHcccHHHHHHccccccccEEEEEEccc
MPGMTAYAGFFEVCSPKQGEYVFVSAASGAVGQLVGQFAKLVGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEPDLDAALKRYFPEGINIYFENVGGKMLDAVLLNMRIQGRITLCGMISQYNNDKPEGVHNLTCLISKRIRMEGFLVPDYFHLYPKFLEMMIPRIKEGKIVYVEDKAEGLESAPAALVGLFSGRNVGKQVVEVAT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGMTAYAGFFEVCSPKQGEYVFVSAASGAVGQLVGQFAKLVGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEPDLDAALKRYFPEGINIYFENVGGKMLDAVLLNMRIQGRITLCGMISQYNNDKPEGVHNLTCLISKRIRMEGFLVPDYFHLYPKFLEMMIPRIKEGKIVYVEDKAEGLESAPAALVGLFSGRNVGKQVVEVATE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADP-dependent alkenal double bond reductase P2 Catalyzes the reduction of the 7-8 double bond of phenylpropanal substrates, such as p-coumaryl aldehyde and coniferyl aldehyde (in vitro). Has activity towards toxic substrates, such as 4-hydroxy-(2E)-nonenal (in vitro) (By similarity). May play a distinct role in plant antioxidant defense and is possibly involved in NAD(P)/NAD(P)h homeostasis.probableQ39173
(+)-pulegone reductase Monoterpene synthase that catalyzes the specific reduction of the 4,8-double bond of (+)-pulegone to produce both (-)-menthone and (+)-isomenthone in a 70:30 ratio. Unable to utilize either (-)-isopiperitenone or (+)-cis-isopulegone, or to catalyze the reverse reaction with (-)-menthone or (+)-isomenthone. Has an absolute requirement for NADPH.probableQ6WAU0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.3.-.-Acting on the CH-CH group of donors.probable
1.3.1.-10-hydroxytaxane O-acetyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J3H, chain A
Confidence level:very confident
Coverage over the Query: 2-208
View the alignment between query and template
View the model in PyMOL