Citrus Sinensis ID: 028556


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MGNGTSTPPEATVYGLYQCRGDLKTTDCSRCIESAVNQISLVCPYTYGASLQLEGCYVRYEHIDFLGKLDTSIWYKKCSKSVNNDVEFFKRRDDVLADLQTAVSFKVSSSGFVEGFAQCLGDLTPADCTTCLAEAIAKLKNLCGSAPAADVFLAQCYARYWASGYYDLTDSSHDDQVGKTVAIIVGVVAGLAILIVFLSICRRAMER
ccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccEEEEcccEEEEEccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHcccccccEEEcccEEEEEEccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHcccc
*******PPEATVYGLYQCRGDLKTTDCSRCIESAVNQISLVCPYTYGASLQLEGCYVRYEHIDFLGKLDTSIWYKKCSKSVNNDVEFFKRRDDVLADLQTAVSFKVSSSGFVEGFAQCLGDLTPADCTTCLAEAIAKLKNLCGSAPAADVFLAQCYARYWASGYYDLTDSSHDDQVGKTVAIIVGVVAGLAILIVFLSICRRAMER
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNGTSTPPEATVYGLYQCRGDLKTTDCSRCIESAVNQISLVCPYTYGASLQLEGCYVRYEHIDFLGKLDTSIWYKKCSKSVNNDVEFFKRRDDVLADLQTAVSFKVSSSGFVEGFAQCLGDLTPADCTTCLAEAIAKLKNLCGSAPAADVFLAQCYARYWASGYYDLTDSSHDDQVGKTVAIIVGVVAGLAILIVFLSICRRAMER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine-rich repeat secretory protein 15 probableQ6NKQ9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A2E, chain A
Confidence level:confident
Coverage over the Query: 72-165
View the alignment between query and template
View the model in PyMOL
Template: 3A2E, chain A
Confidence level:confident
Coverage over the Query: 7-65
View the alignment between query and template
View the model in PyMOL
Template: 2K1K, chain A
Confidence level:probable
Coverage over the Query: 177-204
View the alignment between query and template
View the model in PyMOL