Citrus Sinensis ID: 028558


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MDSIVLPHSISVARLRAPPAGRTSGRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARSSHSFF
ccccccccccccccccccccccccccccccccccccccccccccCEEEccccccHHHHHHHccccccccccccccccccccccEEEcccccccccEEEcccccHHHHHHHHHHcccccccEEcccccEEEEEEHHHHHcccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccEEEcccccHHHHHHHHHHHc
*******HSISV**************TSFALQLPCLLLSRPGCRVFSVLATSS***************************GVYTVGDFMTTKEELHVVKPTTTVDEALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARSSHSFF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSIVLPHSISVARLRAPPAGRTSGRTSFALQLPCLLLSRPGCRVFSVLATSSDRVSALRRSSAVFASGTLTANSAAPSSGVYTVGDFMTTKEELHVVKPTTTVDEALEILVEKRITGFPVIDDDWKLVGLVSDYDLLALDSISGSGRADNSMFPEVDSTWKTFNEVQKLLSKTNGKMVGDLMTPAPVVVRETTNLEDAARSSHSFF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CBS domain-containing protein CBSX1, chloroplastic probableO23193

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SL7, chain A
Confidence level:very confident
Coverage over the Query: 82-140,160-207
View the alignment between query and template
View the model in PyMOL
Template: 2YZQ, chain A
Confidence level:very confident
Coverage over the Query: 11-40,52-145,175-207
View the alignment between query and template
View the model in PyMOL
Template: 4FXS, chain A
Confidence level:very confident
Coverage over the Query: 2-141,174-202
View the alignment between query and template
View the model in PyMOL