Citrus Sinensis ID: 028570

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MAQAMASMAGLRGSSHSQAVLEGSFQLSGPNRLNAPSNSRVAVARPGFTVRAQQASNEPETSRRAMLGLVAAGVASGSFVQAVLADATPIKVGPPPPPSGGLPGTLNSDEPRDLDLPLKERFFIQPLSPAQAAERAKASAKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNVSFFSF
cHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccc
****************SQAVLEG******************************************MLGLVAAGVASGSFVQAVLADATPIKVGPPPPPSGGLPGTLNSDEPRDLDLPLKERFFIQPLSPAQAAERAKASAKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISA**********NLTGKLFQTIGNVSFFSF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQAMASMAGLRGSSHSQAVLEGSFQLSGPNRLNAPSNSRVAVARPGFTVRAQQASNEPETSRRAMLGLVAAGVASGSFVQAVLADATPIKVGPPPPPSGGLPGTLNSDEPRDLDLPLKERFFIQPLSPAQAAERAKASAKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNVSFFSF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Oxygen-evolving enhancer protein 3-2, chloroplastic Required for photosystem II assembly/stability and photoautotrophic growth under low light conditions.confidentQ41932
Oxygen-evolving enhancer protein 3, chloroplastic probableP12301
Oxygen-evolving enhancer protein 3, chloroplastic probableQ0D5P8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VYK, chain A
Confidence level:very confident
Coverage over the Query: 117-206
View the alignment between query and template
View the model in PyMOL