Citrus Sinensis ID: 028572

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------

MASRTVAKDIITLRGSAAIVSEFFGYAANSILYNRGVYPEESFVKVKKYGLPMLLTEDEGVKSFIANLTAQLSEWLEAGKLQRVVLVIMSKATKEVLERWNFSIETDNEVVEKGVSREKSDKEIMREIQAIMRQIASSITYLPCLDETCVFDVLAYTDKDVAVPFTWIESDPKLIANPQMVKLHSFDTKIHKVDTLVSYKNDEWDEQ

cccccccccccHHHHHHHHHHHHHHHHHcEEEEccccccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccEEEEEEEEEEccccHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEccccccccccccccccccccccEEEcCEEEcccEEEEEEEEEEccccccc

*******KDIITLRGSAAIVSEFFGYAANSILYNRGVYPEESFVKVKKYGLPMLLTEDEGVKSFIANLTAQLSEWLEAGKLQRVVLVIMSKATKEVLERWNFSIETDNEVV***********EIMREIQAIMRQIASSITYLPCLDETCVFDVLAYTDKDVAVPFTWIESDPKLIANPQMVKLHSFDTKIHKVDTLVSY********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitotic spindle checkpoint protein MAD2	Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and delays the onset of anaphase when this process is not complete. It inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate.	confident	Q9LU93
Mitotic spindle checkpoint protein MAD2	Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and delays the onset of anaphase when this process is not complete. It inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate.	probable	Q9XFH3
Mitotic spindle assembly checkpoint protein MAD2A	Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and inhibits the activity of the anaphase promoting complex until all chromosomes are aligned at the metaphase plate.	probable	Q556Y9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VFX, chain A
Confidence level:very confident
Coverage over the Query: 1-205
View the alignment between query and template
View the model in PyMOL