Citrus Sinensis ID: 028574


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MASTNLLPLTMLWAIVLLATFSSIQAKKSDQNLKEITNKVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQGGDFTLGDGRGGESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSKVVVADSGELPL
cccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEccEEEEEEEEEEccccccHHHHHHHHHHHccccccccccccccccccccEEccccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEcccccccccccCEEEEEEEcHHHHHHHHccccccccccccEEEEccccccc
*****LLPLTMLWAIVLLATFSSIQAKKSDQNLKEITNKVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQGGDFTLGDGRGGESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVE************VVVADSGELPL
xxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTNLLPLTMLWAIVLLATFSSIQAKKSDQNLKEITNKVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQGGDFTLGDGRGGESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSKVVVADSGELPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase CYP20-1 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Seems to be involved in root development.confidentQ9SP02
Peptidyl-prolyl cis-trans isomerase 7 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.confidentP52015
Peptidyl-prolyl cis-trans isomerase B PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.probableP0CP78

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IHG, chain A
Confidence level:very confident
Coverage over the Query: 37-206
View the alignment between query and template
View the model in PyMOL