Citrus Sinensis ID: 028580

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------

MASAAAAASSAPTIWLTGQGLGGRSTRLPFHWRNKKMEQRKTGGRISAKFDLKPPPYPLLGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLVIEK

cccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHcccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccEEEEccccccccccccccEEEEccccccHHccccccccc

********SSAPTIWLTGQGLGGRSTRLPFHWRNKKMEQRKTGGRISAKFDLKPPPYPLLGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKP*****PSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLVIE*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.15.-.-	Acting on superoxide as acceptor.	probable
1.15.1.-	Acting on superoxide as acceptor.	probable
1.15.1.1	Superoxide dismutase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UNF, chain X
Confidence level:very confident
Coverage over the Query: 13-203
View the alignment between query and template
View the model in PyMOL