Citrus Sinensis ID: 028580
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 207 | ||||||
| 195548074 | 163 | iron superoxide dismutase [Citrus maxima | 0.676 | 0.858 | 0.971 | 1e-64 | |
| 380085077 | 305 | Fe superoxide dismutase [Jatropha curcas | 0.855 | 0.580 | 0.612 | 3e-63 | |
| 374307307 | 309 | iron superoxide dismutase, partial [Litc | 0.946 | 0.634 | 0.609 | 3e-62 | |
| 15241373 | 305 | Fe superoxide dismutase 2 [Arabidopsis t | 0.797 | 0.540 | 0.592 | 5e-61 | |
| 312837926 | 278 | Fe superoxide dismutase 2 [Brassica rapa | 0.850 | 0.633 | 0.587 | 6e-61 | |
| 356499596 | 313 | PREDICTED: superoxide dismutase [Fe], ch | 0.927 | 0.613 | 0.549 | 1e-60 | |
| 225454956 | 306 | PREDICTED: superoxide dismutase [Fe], ch | 0.927 | 0.627 | 0.547 | 3e-59 | |
| 297795915 | 305 | hypothetical protein ARALYDRAFT_918143 [ | 0.850 | 0.577 | 0.572 | 4e-59 | |
| 255539971 | 305 | superoxide dismutase [fe], putative [Ric | 0.951 | 0.645 | 0.589 | 8e-59 | |
| 356534787 | 309 | PREDICTED: superoxide dismutase [Fe], ch | 0.797 | 0.533 | 0.592 | 5e-58 |
| >gi|195548074|gb|ACG49262.1| iron superoxide dismutase [Citrus maxima] | Back alignment and taxonomy information |
|---|
Score = 251 bits (641), Expect = 1e-64, Method: Compositional matrix adjust.
Identities = 136/140 (97%), Positives = 136/140 (97%)
Query: 60 LGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDF 119
LGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDF
Sbjct: 24 LGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDF 83
Query: 120 GSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVN 179
GSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVN
Sbjct: 84 GSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVN 143
Query: 180 PLVWDYSPLLTIDVWEVNIY 199
PLVWDYS LLTIDVWE Y
Sbjct: 144 PLVWDYSSLLTIDVWEHAYY 163
|
Source: Citrus maxima Species: Citrus maxima Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|380085077|gb|AFD34189.1| Fe superoxide dismutase [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|374307307|gb|AEY78486.2| iron superoxide dismutase, partial [Litchi chinensis] | Back alignment and taxonomy information |
|---|
| >gi|15241373|ref|NP_199923.1| Fe superoxide dismutase 2 [Arabidopsis thaliana] gi|8843846|dbj|BAA97372.1| unnamed protein product [Arabidopsis thaliana] gi|21537292|gb|AAM61633.1| Fe-superoxide dismutase precursor [Arabidopsis thaliana] gi|28393352|gb|AAO42100.1| putative iron superoxide dismutase [Arabidopsis thaliana] gi|28827610|gb|AAO50649.1| putative iron superoxide dismutase [Arabidopsis thaliana] gi|110737010|dbj|BAF00460.1| hypothetical protein [Arabidopsis thaliana] gi|332008651|gb|AED96034.1| Fe superoxide dismutase 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|312837926|gb|ADR01110.1| Fe superoxide dismutase 2 [Brassica rapa] | Back alignment and taxonomy information |
|---|
| >gi|356499596|ref|XP_003518624.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225454956|ref|XP_002280522.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Vitis vinifera] gi|297744964|emb|CBI38556.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297795915|ref|XP_002865842.1| hypothetical protein ARALYDRAFT_918143 [Arabidopsis lyrata subsp. lyrata] gi|297311677|gb|EFH42101.1| hypothetical protein ARALYDRAFT_918143 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255539971|ref|XP_002511050.1| superoxide dismutase [fe], putative [Ricinus communis] gi|223550165|gb|EEF51652.1| superoxide dismutase [fe], putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356534787|ref|XP_003535933.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 207 | ||||||
| TAIR|locus:2176167 | 305 | FSD2 "AT5G51100" [Arabidopsis | 0.661 | 0.449 | 0.543 | 1.2e-41 | |
| TAIR|locus:2117273 | 212 | FSD1 "Fe superoxide dismutase | 0.410 | 0.400 | 0.482 | 4e-32 | |
| TAIR|locus:2166953 | 263 | FSD3 "Fe superoxide dismutase | 0.584 | 0.460 | 0.401 | 2.8e-27 | |
| UNIPROTKB|Q0C4B8 | 220 | sodB "Superoxide dismutase" [H | 0.410 | 0.386 | 0.4 | 1.2e-19 | |
| UNIPROTKB|P0AGD3 | 193 | sodB [Escherichia coli K-12 (t | 0.381 | 0.409 | 0.357 | 1.1e-17 | |
| TIGR_CMR|SPO_2340 | 199 | SPO_2340 "superoxide dismutase | 0.400 | 0.417 | 0.337 | 3.7e-17 | |
| UNIPROTKB|Q5VSB7 | 255 | LOC_Os06g05110 "Superoxide dis | 0.584 | 0.474 | 0.343 | 8.6e-17 | |
| TIGR_CMR|APH_0371 | 206 | APH_0371 "Fe superoxide dismut | 0.632 | 0.635 | 0.373 | 2.9e-16 | |
| TIGR_CMR|CBU_1708 | 193 | CBU_1708 "superoxide dismutase | 0.304 | 0.326 | 0.380 | 1.9e-14 | |
| TIGR_CMR|NSE_0843 | 205 | NSE_0843 "superoxide dismutase | 0.584 | 0.590 | 0.359 | 4.9e-14 |
| TAIR|locus:2176167 FSD2 "AT5G51100" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 391 (142.7 bits), Expect = 1.2e-41, Sum P(2) = 1.2e-41
Identities = 75/138 (54%), Positives = 84/138 (60%)
Query: 62 DGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWXXXXXXXXXXXXXXXXXLIERDFGS 121
D SLE+VV+ SYNKG++LPAFNNAAQAWNH+FFW LIERDFGS
Sbjct: 99 DALSLEEVVLLSYNKGNMLPAFNNAAQAWNHEFFWESIQPGGGGKPTGELLRLIERDFGS 158
Query: 122 XXXXXXXXXXXXXTQFGSGWAWLVYKXXXXXXXXXXXXPLPSEKDKSLLVVKTPNAVNPL 181
+ FGSGW WL YK PLP E+DK L++VKTPNAVNPL
Sbjct: 159 FEEFLERFKSAAASNFGSGWTWLAYKANRLDVANAVN-PLPKEEDKKLVIVKTPNAVNPL 217
Query: 182 VWDYSPLLTIDVWEVNIY 199
VWDYSPLLTID WE Y
Sbjct: 218 VWDYSPLLTIDTWEHAYY 235
|
|
| TAIR|locus:2117273 FSD1 "Fe superoxide dismutase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166953 FSD3 "Fe superoxide dismutase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0C4B8 sodB "Superoxide dismutase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0AGD3 sodB [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_2340 SPO_2340 "superoxide dismutase, Fe" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5VSB7 LOC_Os06g05110 "Superoxide dismutase [Fe] 2, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|APH_0371 APH_0371 "Fe superoxide dismutase" [Anaplasma phagocytophilum HZ (taxid:212042)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1708 CBU_1708 "superoxide dismutase (fe)" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|NSE_0843 NSE_0843 "superoxide dismutase, Fe" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| FSD2 | FSD2 (FE SUPEROXIDE DISMUTASE 2); superoxide dismutase; Fe superoxide dismutase whose mRNA levels are increased in response to exposure to UV-B. ; Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity) (305 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| CAT1 | • | • | 0.994 | ||||||||
| AT4G35090 | • | • | 0.990 | ||||||||
| APX1 | • | 0.968 | |||||||||
| GR | • | 0.937 | |||||||||
| MDHAR | • | 0.867 | |||||||||
| ATGPX2 | • | 0.825 | |||||||||
| AT1G63460 | • | 0.821 | |||||||||
| DHAR2 | • | 0.821 | |||||||||
| DHAR3 | • | 0.788 | |||||||||
| AT1G31540 | • | 0.788 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 207 | |||
| PLN02685 | 299 | PLN02685, PLN02685, iron superoxide dismutase | 2e-94 | |
| PLN02184 | 212 | PLN02184, PLN02184, superoxide dismutase [Fe] | 1e-54 | |
| COG0605 | 204 | COG0605, SodA, Superoxide dismutase [Inorganic ion | 1e-48 | |
| PLN02622 | 261 | PLN02622, PLN02622, iron superoxide dismutase | 6e-47 | |
| PTZ00078 | 193 | PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Pro | 2e-32 | |
| PRK10543 | 193 | PRK10543, PRK10543, superoxide dismutase; Provisio | 4e-32 | |
| pfam02777 | 106 | pfam02777, Sod_Fe_C, Iron/manganese superoxide dis | 7e-31 | |
| PRK10925 | 206 | PRK10925, PRK10925, superoxide dismutase; Provisio | 2e-20 | |
| PLN02471 | 231 | PLN02471, PLN02471, superoxide dismutase [Mn] | 2e-14 | |
| pfam00081 | 82 | pfam00081, Sod_Fe_N, Iron/manganese superoxide dis | 1e-06 |
| >gnl|CDD|215369 PLN02685, PLN02685, iron superoxide dismutase | Back alignment and domain information |
|---|
Score = 277 bits (709), Expect = 2e-94
Identities = 139/235 (59%), Positives = 157/235 (66%), Gaps = 42/235 (17%)
Query: 1 MASAAAAASSAPTIWLTGQGLGGRSTRLPFHWRNKKMEQRKTG--GRISAKFDLKPPPYP 58
+A A+ S L QG R W+ K+ + G I+AKF+LKPPPYP
Sbjct: 1 AVTATPASLSLSPALLPSQGPSRRM-----QWKGKRRTCTRKAVSGVITAKFELKPPPYP 55
Query: 59 L-------------------------------LG---DGKSLEDVVIASYNKGDLLPAFN 84
L +G DG SLEDVV+ +YNKGD+LPAFN
Sbjct: 56 LDALEPHMSRETLEYHWGKHHRAYVDNLNKQIVGTELDGMSLEDVVLITYNKGDMLPAFN 115
Query: 85 NAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWL 144
NAAQAWNH+FFWESMKPGGGGKPSGELL LIERDFGSFE+F+EEFK+AAATQFGSGWAWL
Sbjct: 116 NAAQAWNHEFFWESMKPGGGGKPSGELLQLIERDFGSFERFVEEFKSAAATQFGSGWAWL 175
Query: 145 VYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSPLLTIDVWEVNIY 199
YKA NR DV NAVNP PSE+DK L+VVK+PNAVNPLVWDYSPLLTIDVWE Y
Sbjct: 176 AYKA-NRLDVGNAVNPCPSEEDKKLVVVKSPNAVNPLVWDYSPLLTIDVWEHAYY 229
|
Length = 299 |
| >gnl|CDD|177838 PLN02184, PLN02184, superoxide dismutase [Fe] | Back alignment and domain information |
|---|
| >gnl|CDD|223678 COG0605, SodA, Superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|166263 PLN02622, PLN02622, iron superoxide dismutase | Back alignment and domain information |
|---|
| >gnl|CDD|185432 PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182534 PRK10543, PRK10543, superoxide dismutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202388 pfam02777, Sod_Fe_C, Iron/manganese superoxide dismutases, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|182843 PRK10925, PRK10925, superoxide dismutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215262 PLN02471, PLN02471, superoxide dismutase [Mn] | Back alignment and domain information |
|---|
| >gnl|CDD|200985 pfam00081, Sod_Fe_N, Iron/manganese superoxide dismutases, alpha-hairpin domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| COG0605 | 204 | SodA Superoxide dismutase [Inorganic ion transport | 100.0 | |
| PLN02184 | 212 | superoxide dismutase [Fe] | 100.0 | |
| PRK10543 | 193 | superoxide dismutase; Provisional | 100.0 | |
| PLN02685 | 299 | iron superoxide dismutase | 100.0 | |
| PLN02622 | 261 | iron superoxide dismutase | 100.0 | |
| PRK10925 | 206 | superoxide dismutase; Provisional | 100.0 | |
| PTZ00078 | 193 | Superoxide dismutase [Fe]; Provisional | 100.0 | |
| PLN02471 | 231 | superoxide dismutase [Mn] | 100.0 | |
| KOG0876 | 234 | consensus Manganese superoxide dismutase [Inorgani | 100.0 | |
| PF02777 | 106 | Sod_Fe_C: Iron/manganese superoxide dismutases, C- | 100.0 | |
| PF00081 | 82 | Sod_Fe_N: Iron/manganese superoxide dismutases, al | 99.84 |
| >COG0605 SodA Superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.6e-59 Score=389.39 Aligned_cols=160 Identities=41% Similarity=0.734 Sum_probs=147.0
Q ss_pred chhhhccCCCCCcchHHHHHHhh-HHHHHHHHHHHhcccc-CCCCCCCCCCCCCCHHHHHHHhhcCCCchhhhchhhHHh
Q 028580 13 TIWLTGQGLGGRSTRLPFHWRNK-KMEQRKTGGRISAKFD-LKPPPYPLLGDGKSLEDVVIASYNKGDLLPAFNNAAQAW 90 (207)
Q Consensus 13 ~~~~~~~~g~lS~~~l~~H~~kh-~~YV~~LN~~l~~~~~-~~~~~~~~~~~~~sl~~li~~~~~~~~~~~ifN~ag~~~ 90 (207)
.++|| .||++||++||+|| |+||++||+++++..+ + ++.+++++++.....+. .+|||+|||+
T Consensus 14 ~ALeP----~is~et~~~Hh~kHH~~YV~~lN~~~~~~~~~~---------~~~~~e~~~~~~~~~~~--~~~nn~~gh~ 78 (204)
T COG0605 14 DALEP----HISAETMELHHDKHHQTYVNNLNAALEGLTEEL---------EDLSLEEIIKKLAGLPA--ALFNNAGGHW 78 (204)
T ss_pred ccccc----ccCHHHHHHHHHHHHHHHHHHHHHHHhhhhhhc---------ccCCHHHHHHHHhcccH--HHHhcchhhh
Confidence 57788 79999999999999 9999999999999643 5 77899999876544332 5899999999
Q ss_pred hHHHHHhhcCCC-CCCCCcHHHHHHHHhhcCCHHHHHHHHHHHHhcCCCCeEEEEEEecCccccccccCCCCCCCCCCce
Q 028580 91 NHDFFWESMKPG-GGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSL 169 (207)
Q Consensus 91 NH~ffw~~L~P~-~~~~p~g~L~~~I~~~FGS~d~fk~~F~~~A~~~fGsGWvWLv~~~~~~l~~~~~~~~~~~~~~~~L 169 (207)
||+|||++|+|+ ++++|+|+|+++|+++|||+|+||++|.++|.++|||||+|||+|+ +++|
T Consensus 79 NH~~fw~~l~p~~gg~~p~g~L~~aI~~~FGS~d~fk~~f~~aa~~~fGsGWawLv~~~-----------------~~kL 141 (204)
T COG0605 79 NHSLFWENLSPGGGGGKPTGELAAAINKDFGSFDKFKEEFTAAAASVFGSGWAWLVYDP-----------------DGKL 141 (204)
T ss_pred hHHHHHhhcCCCCCCCCCCHHHHHHHHHHhcCHHHHHHHHHHHHhhCCCCceEEEEECC-----------------CCcE
Confidence 999999999995 7889999999999999999999999999999999999999999994 4699
Q ss_pred EEEeecCCCCCCCCCCeeeeEeccchhhhhhhccc
Q 028580 170 LVVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLV 204 (207)
Q Consensus 170 ~i~~t~n~~~p~~~~~~PLL~iDvWEHAYyldy~~ 204 (207)
.|++|+||++|++.+.+|||||||||||||+||+.
T Consensus 142 ~i~~t~n~~~p~~~~~~PiL~lDvWEHAYYldY~N 176 (204)
T COG0605 142 EIVSTYNQDTPLMWGSVPLLGLDVWEHAYYLDYGN 176 (204)
T ss_pred EEEeccCCCCcccCCCCceEEecchHHHHHHHhcc
Confidence 99999999999999999999999999999999986
|
|
| >PLN02184 superoxide dismutase [Fe] | Back alignment and domain information |
|---|
| >PRK10543 superoxide dismutase; Provisional | Back alignment and domain information |
|---|
| >PLN02685 iron superoxide dismutase | Back alignment and domain information |
|---|
| >PLN02622 iron superoxide dismutase | Back alignment and domain information |
|---|
| >PRK10925 superoxide dismutase; Provisional | Back alignment and domain information |
|---|
| >PTZ00078 Superoxide dismutase [Fe]; Provisional | Back alignment and domain information |
|---|
| >PLN02471 superoxide dismutase [Mn] | Back alignment and domain information |
|---|
| >KOG0876 consensus Manganese superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF02777 Sod_Fe_C: Iron/manganese superoxide dismutases, C-terminal domain Note: SCOP classifies the two domains separately | Back alignment and domain information |
|---|
| >PF00081 Sod_Fe_N: Iron/manganese superoxide dismutases, alpha-hairpin domain Note: SCOP classifies the two domains separately | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 207 | ||||
| 1unf_X | 238 | The Crystal Structure Of The Eukaryotic Fesod From | 2e-37 | ||
| 1my6_A | 199 | The 1.6 A Structure Of Fe-superoxide Dismutase From | 4e-17 | ||
| 3js4_A | 227 | Crystal Structure Of Iron Superoxide Dismutase From | 1e-15 | ||
| 1isa_A | 192 | Structure-Function In E. Coli Iron Superoxide Dismu | 6e-14 | ||
| 2nyb_A | 192 | Crystal Structure Of E.Coli Iron Superoxide Dismuta | 1e-13 | ||
| 1za5_A | 192 | Q69h-Fesod Length = 192 | 2e-13 | ||
| 3h1s_A | 195 | Crystal Structure Of Superoxide Dismutase From Fran | 5e-12 | ||
| 3sdp_A | 195 | The 2.1 Angstroms Resolution Structure Of Iron Supe | 2e-11 | ||
| 3tqj_A | 210 | Structure Of The Superoxide Dismutase (Fe) (Sodb) F | 4e-11 | ||
| 1dt0_A | 197 | Cloning, Sequence, And Crystallographic Structure O | 5e-11 | ||
| 4h3e_A | 241 | Crystal Structure Of A Putative Iron Superoxide Dis | 4e-10 | ||
| 2w7w_A | 194 | The Crystal Structure Of Iron Superoxide Dismutase | 5e-10 | ||
| 4f2n_A | 230 | Crystal Structure Of Iron Superoxide Dismutase From | 5e-10 | ||
| 2cw2_A | 226 | Crystal Structure Of Superoxide Dismutase From P. M | 6e-10 | ||
| 3cei_A | 213 | Crystal Structure Of Superoxide Dismutase From Heli | 9e-10 | ||
| 3lio_A | 192 | X-Ray Structure Of The Iron Superoxide Dismutase Fr | 2e-09 | ||
| 2a03_A | 206 | Superoxide Dismutase Protein From Plasmodium Berghe | 2e-09 | ||
| 2awp_A | 198 | Crystal Structure Of Plasmodium Knowlesi Structure | 1e-08 | ||
| 3esf_A | 197 | Crystal Structure Of The Enzyme Fe-Superoxide Dismu | 1e-08 | ||
| 1ues_A | 191 | Crystal Structure Of Porphyromonas Gingivalis Sod L | 2e-08 | ||
| 2bpi_A | 206 | Stucture Of Iron Dependent Superoxide Dismutase Fro | 2e-08 | ||
| 2goj_A | 197 | The Crystal Structure Of The Enzyme Fe-Superoxide D | 2e-08 | ||
| 3tjt_A | 208 | Crystal Structure Analysis Of The Superoxide Dismut | 3e-08 | ||
| 1qnn_A | 191 | Cambialistic Superoxide Dismutase From Porphyromona | 9e-08 | ||
| 1xuq_A | 212 | Crystal Structure Of Soda-1 (Ba4499) From Bacillus | 2e-07 | ||
| 2gpc_A | 194 | The Crystal Structure Of The Enzyme Fe-Superoxide D | 5e-07 | ||
| 3mds_A | 203 | Maganese Superoxide Dismutase From Thermus Thermoph | 9e-07 | ||
| 1en5_A | 205 | Crystal Structure Analysis Of The E. Coli Manganese | 5e-06 | ||
| 1vew_A | 205 | Manganese Superoxide Dismutase From Escherichia Col | 5e-06 | ||
| 1i08_A | 205 | Crystal Structure Analysis Of The H30a Mutant Of Ma | 5e-06 | ||
| 1en4_A | 205 | Crystal Structure Analysis Of The E. Coli Manganese | 5e-06 | ||
| 1en6_A | 205 | Crystal Structure Analysis Of The E. Coli Manganese | 6e-06 | ||
| 1i0h_A | 205 | Crystal Structure Of The E. Coli Manganese Superoxi | 8e-06 | ||
| 1y67_A | 229 | Crystal Structure Of Manganese Superoxide Dismutase | 2e-05 | ||
| 3kky_A | 211 | Structure Of Manganese Superoxide Dismutase From De | 2e-05 | ||
| 2cdy_A | 231 | Manganese Superoxide Dismutase (Mn-Sod) From Deinoc | 3e-05 | ||
| 1gv3_A | 248 | The 2.0 Angstrom Resolution Structure Of The Cataly | 5e-05 | ||
| 2rcv_A | 202 | Crystal Structure Of The Bacillus Subtilis Superoxi | 1e-04 | ||
| 1jr9_A | 202 | Crystal Structure Of Manganese Superoxide Dismutase | 3e-04 | ||
| 2cw3_A | 280 | X-Ray Structure Of Pmsod2, Superoxide Dismutase Fro | 4e-04 |
| >pdb|1UNF|X Chain X, The Crystal Structure Of The Eukaryotic Fesod From Vigna Unguiculata Suggests A New Enzymatic Mechanism Length = 238 | Back alignment and structure |
|
| >pdb|1MY6|A Chain A, The 1.6 A Structure Of Fe-superoxide Dismutase From The Thermophilic Cyanobacterium Thermosynechococcus Elongatus : Correlation Of Epr And Structural Characteristics Length = 199 | Back alignment and structure |
| >pdb|3JS4|A Chain A, Crystal Structure Of Iron Superoxide Dismutase From Anaplasma Phagocytophilum Length = 227 | Back alignment and structure |
| >pdb|1ISA|A Chain A, Structure-Function In E. Coli Iron Superoxide Dismutase: Comparisons With The Manganese Enzyme From T. Thermophilus Length = 192 | Back alignment and structure |
| >pdb|2NYB|A Chain A, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e At 1.1 Angstrom Resolution Length = 192 | Back alignment and structure |
| >pdb|1ZA5|A Chain A, Q69h-Fesod Length = 192 | Back alignment and structure |
| >pdb|3H1S|A Chain A, Crystal Structure Of Superoxide Dismutase From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 195 | Back alignment and structure |
| >pdb|3SDP|A Chain A, The 2.1 Angstroms Resolution Structure Of Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 195 | Back alignment and structure |
| >pdb|3TQJ|A Chain A, Structure Of The Superoxide Dismutase (Fe) (Sodb) From Coxiella Burnetii Length = 210 | Back alignment and structure |
| >pdb|1DT0|A Chain A, Cloning, Sequence, And Crystallographic Structure Of Recombinant Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 197 | Back alignment and structure |
| >pdb|4H3E|A Chain A, Crystal Structure Of A Putative Iron Superoxide Dismutase From Trypanosoma Cruzi Bound To Iron Length = 241 | Back alignment and structure |
| >pdb|2W7W|A Chain A, The Crystal Structure Of Iron Superoxide Dismutase From Aliivibrio Salmonicida. Length = 194 | Back alignment and structure |
| >pdb|4F2N|A Chain A, Crystal Structure Of Iron Superoxide Dismutase From Leishmania Major Length = 230 | Back alignment and structure |
| >pdb|2CW2|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Marinus Length = 226 | Back alignment and structure |
| >pdb|3CEI|A Chain A, Crystal Structure Of Superoxide Dismutase From Helicobacter Pylori Length = 213 | Back alignment and structure |
| >pdb|3LIO|A Chain A, X-Ray Structure Of The Iron Superoxide Dismutase From Pseudoalteromonas Haloplanktis (Crystal Form I) Length = 192 | Back alignment and structure |
| >pdb|2A03|A Chain A, Superoxide Dismutase Protein From Plasmodium Berghei Length = 206 | Back alignment and structure |
| >pdb|2AWP|A Chain A, Crystal Structure Of Plasmodium Knowlesi Structure Of Iron Super-Oxide Dismutase Length = 198 | Back alignment and structure |
| >pdb|3ESF|A Chain A, Crystal Structure Of The Enzyme Fe-Superoxide Dismutase Tbsodb2 From Trypanosoma Brucei Length = 197 | Back alignment and structure |
| >pdb|1UES|A Chain A, Crystal Structure Of Porphyromonas Gingivalis Sod Length = 191 | Back alignment and structure |
| >pdb|2BPI|A Chain A, Stucture Of Iron Dependent Superoxide Dismutase From P. Falciparum. Length = 206 | Back alignment and structure |
| >pdb|2GOJ|A Chain A, The Crystal Structure Of The Enzyme Fe-Superoxide Dismutase From Plasmodium Falciparum Length = 197 | Back alignment and structure |
| >pdb|3TJT|A Chain A, Crystal Structure Analysis Of The Superoxide Dismutase From Clostridium Difficile Length = 208 | Back alignment and structure |
| >pdb|1QNN|A Chain A, Cambialistic Superoxide Dismutase From Porphyromonas Gingivalis Length = 191 | Back alignment and structure |
| >pdb|1XUQ|A Chain A, Crystal Structure Of Soda-1 (Ba4499) From Bacillus Anthracis At 1.8a Resolution. Length = 212 | Back alignment and structure |
| >pdb|2GPC|A Chain A, The Crystal Structure Of The Enzyme Fe-Superoxide Dismutase From Trypanosoma Cruzi Length = 194 | Back alignment and structure |
| >pdb|3MDS|A Chain A, Maganese Superoxide Dismutase From Thermus Thermophilus Length = 203 | Back alignment and structure |
| >pdb|1EN5|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Y34f Mutant Length = 205 | Back alignment and structure |
| >pdb|1VEW|A Chain A, Manganese Superoxide Dismutase From Escherichia Coli Length = 205 | Back alignment and structure |
| >pdb|1I08|A Chain A, Crystal Structure Analysis Of The H30a Mutant Of Manganese Superoxide Dismutase From E. Coli Length = 205 | Back alignment and structure |
| >pdb|1EN4|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146h Mutant Length = 205 | Back alignment and structure |
| >pdb|1EN6|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146l Mutant Length = 205 | Back alignment and structure |
| >pdb|1I0H|A Chain A, Crystal Structure Of The E. Coli Manganese Superoxide Dismutase Mutant Y174f At 1.35 Angstroms Resolution. Length = 205 | Back alignment and structure |
| >pdb|1Y67|A Chain A, Crystal Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans Length = 229 | Back alignment and structure |
| >pdb|3KKY|A Chain A, Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans In The Orthorhombic Space Group P212121: A Case Study Of Mistaken Identity Length = 211 | Back alignment and structure |
| >pdb|2CDY|A Chain A, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus Radiodurans Length = 231 | Back alignment and structure |
| >pdb|1GV3|A Chain A, The 2.0 Angstrom Resolution Structure Of The Catalytic Portion Of A Cyanobacterial Membrane-Bound Manganese Superoxide Dismutase Length = 248 | Back alignment and structure |
| >pdb|2RCV|A Chain A, Crystal Structure Of The Bacillus Subtilis Superoxide Dismutase Length = 202 | Back alignment and structure |
| >pdb|1JR9|A Chain A, Crystal Structure Of Manganese Superoxide Dismutases From Bacillus Halodenitrificans Length = 202 | Back alignment and structure |
| >pdb|2CW3|A Chain A, X-Ray Structure Of Pmsod2, Superoxide Dismutase From Perkinsus Marinus Length = 280 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 207 | |||
| 1unf_X | 238 | Iron superoxide dismutase; oxidoreductase, eukaryo | 7e-71 | |
| 1my6_A | 199 | Iron (III) superoxide dismutase; iron speroxide di | 5e-64 | |
| 3js4_A | 227 | Superoxide dismutase; niaid, ssgcid, seattle struc | 4e-62 | |
| 1uer_A | 191 | SOD, superoxide dismutase; metal-specific, cambial | 3e-60 | |
| 2nyb_A | 192 | Superoxide dismutase [FE]; iron superoxide dismuta | 4e-60 | |
| 3tqj_A | 210 | Superoxide dismutase [FE]; oxidoreductase; 2.00A { | 4e-60 | |
| 1dt0_A | 197 | Superoxide dismutase; pseudomonas ovalis, oxidored | 7e-60 | |
| 4f2n_A | 230 | Superoxide dismutase; ssgcid, NIH, niaid, SBRI, em | 8e-60 | |
| 2awp_A | 198 | Iron super-oxide dismutase; structural genomics, s | 7e-59 | |
| 3lio_A | 192 | Iron superoxide dismutase; cold adaptation, flexib | 8e-59 | |
| 2cw2_A | 226 | Superoxide dismutase 1; SOD, oxidoreductase; 1.86A | 2e-58 | |
| 2gpc_A | 194 | Iron superoxide dismutase; alpha+beta structure, o | 2e-58 | |
| 3h1s_A | 195 | Superoxide dismutase; SOBD, csgid, oxidoreductase, | 1e-57 | |
| 3cei_A | 213 | Superoxide dismutase; oxidoreductase; 2.40A {Helic | 4e-57 | |
| 2rcv_A | 202 | Superoxide dismutase [MN]; bacillus subtilis,super | 5e-56 | |
| 1gv3_A | 248 | Manganese superoxide dismutase; anabaena PCC 7120, | 3e-54 | |
| 2cw3_A | 280 | Pmsod2, iron superoxide dismutase; oxidoreductase; | 3e-54 | |
| 1xre_A | 217 | SODA-2, superoxide dismutase; spine, oxidoreductas | 2e-53 | |
| 3kky_A | 211 | Mnsod, superoxide dismutase [MN]; manganese, ME bi | 3e-51 | |
| 1mng_A | 203 | Manganese superoxide dismutase; oxidoreductase(sup | 3e-50 | |
| 1ix9_A | 205 | Mnsod, superoxide dismutase; manganese superoxide | 1e-47 | |
| 1ma1_A | 205 | Superoxide dismutase; metal specificity, azide inh | 2e-46 | |
| 4ffk_A | 223 | Superoxide dismutase; oxidoreductase, superoxide a | 2e-45 | |
| 1coj_A | 212 | Protein (superoxide dismutase); oxidoreductase; 1. | 3e-45 | |
| 1b06_A | 210 | Protein (superoxide dismutase); oxidoreductase; 2. | 4e-45 | |
| 1ids_A | 207 | Iron superoxide dismutase; 2.00A {Mycobacterium tu | 7e-45 | |
| 1bsm_A | 201 | Superoxide dismutase; oxidoreductase; 1.35A {Propi | 6e-43 | |
| 1pl4_A | 198 | Superoxide dismutase [MN], mitochondrial; oxidored | 6e-43 | |
| 3ak2_A | 214 | Superoxide dismutase [MN/FE]; cambialistic, oxidor | 8e-43 | |
| 3rn4_A | 215 | Superoxide dismutase [MN], mitochondrial; mitochon | 1e-42 | |
| 3dc5_A | 195 | Superoxide dismutase [MN] 2; alpha hairpin N domai | 3e-40 | |
| 3qvn_A | 206 | Manganese-containing superoxide dismutase; Mn supe | 1e-39 | |
| 1kkc_A | 221 | Mnsod, manganese superoxide dismutase; homotetrame | 1e-37 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-06 |
| >1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 Length = 238 | Back alignment and structure |
|---|
Score = 214 bits (547), Expect = 7e-71
Identities = 116/190 (61%), Positives = 137/190 (72%), Gaps = 36/190 (18%)
Query: 41 KTGGRISAKFDLKPPPYP-------------------------------LLG---DGKSL 66
K G +++AKF+LKPPPYP ++G DGKSL
Sbjct: 10 KEGPKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTELDGKSL 69
Query: 67 EDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFL 126
E++++ +YNKGD+LPAFNNAAQ WNHDFFWE MKPGGGGKPSGELL LIERDFGSFEKFL
Sbjct: 70 EEIIVTAYNKGDILPAFNNAAQVWNHDFFWECMKPGGGGKPSGELLELIERDFGSFEKFL 129
Query: 127 EEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWD-Y 185
+EFKAAAATQFGSGWAWL YKA ++ D NA NP +++D L+V+K+PNAVNPLVW Y
Sbjct: 130 DEFKAAAATQFGSGWAWLAYKA-SKLDGENAANPPSADEDNKLVVIKSPNAVNPLVWGGY 188
Query: 186 SPLLTIDVWE 195
PLLTIDVWE
Sbjct: 189 YPLLTIDVWE 198
|
| >1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 Length = 199 | Back alignment and structure |
|---|
| >3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum} Length = 227 | Back alignment and structure |
|---|
| >1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A Length = 191 | Back alignment and structure |
|---|
| >2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A Length = 192 | Back alignment and structure |
|---|
| >3tqj_A Superoxide dismutase [FE]; oxidoreductase; 2.00A {Coxiella burnetii} Length = 210 | Back alignment and structure |
|---|
| >1dt0_A Superoxide dismutase; pseudomonas ovalis, oxidoreductase; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 Length = 197 | Back alignment and structure |
|---|
| >4f2n_A Superoxide dismutase; ssgcid, NIH, niaid, SBRI, emerald biostructures, structural national institute of allergy and infectious diseases; 1.85A {Leishmania major} Length = 230 | Back alignment and structure |
|---|
| >2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A Length = 198 | Back alignment and structure |
|---|
| >3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Length = 192 | Back alignment and structure |
|---|
| >2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} Length = 226 | Back alignment and structure |
|---|
| >2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A Length = 194 | Back alignment and structure |
|---|
| >3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structura genomics; 1.90A {Francisella tularensis subsp} Length = 195 | Back alignment and structure |
|---|
| >3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Length = 213 | Back alignment and structure |
|---|
| >2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A Length = 202 | Back alignment and structure |
|---|
| >1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 Length = 248 | Back alignment and structure |
|---|
| >2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} Length = 280 | Back alignment and structure |
|---|
| >1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} Length = 217 | Back alignment and structure |
|---|
| >3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A Length = 211 | Back alignment and structure |
|---|
| >1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A Length = 203 | Back alignment and structure |
|---|
| >1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 3ot7_A 1en5_A 1en4_A 1i08_A 1en6_A Length = 205 | Back alignment and structure |
|---|
| >1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 Length = 205 | Back alignment and structure |
|---|
| >4ffk_A Superoxide dismutase; oxidoreductase, superoxide acceptor; 1.76A {Acidilobus saccharovorans} Length = 223 | Back alignment and structure |
|---|
| >1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 Length = 212 | Back alignment and structure |
|---|
| >1b06_A Protein (superoxide dismutase); oxidoreductase; 2.20A {Sulfolobus acidocaldarius} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A Length = 210 | Back alignment and structure |
|---|
| >1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A Length = 207 | Back alignment and structure |
|---|
| >1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichii subspshermanii} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A Length = 201 | Back alignment and structure |
|---|
| >1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... Length = 198 | Back alignment and structure |
|---|
| >3ak2_A Superoxide dismutase [MN/FE]; cambialistic, oxidoreductase; 1.35A {Aeropyrum pernix} PDB: 3ak1_A 3ak3_A 1p7g_A 3evk_A Length = 214 | Back alignment and structure |
|---|
| >3rn4_A Superoxide dismutase [MN], mitochondrial; mitochondrial manganese superoxide dismutase, iron-binding, mitochondrion, oxidoreductase; 1.79A {Saccharomyces cerevisiae} PDB: 3bfr_A 3lsu_A* Length = 215 | Back alignment and structure |
|---|
| >3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A Length = 195 | Back alignment and structure |
|---|
| >3qvn_A Manganese-containing superoxide dismutase; Mn superoxide dismutase, oxidoreductase; 2.60A {Candida albicans} Length = 206 | Back alignment and structure |
|---|
| >1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 Length = 221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| 1my6_A | 199 | Iron (III) superoxide dismutase; iron speroxide di | 100.0 | |
| 3lio_A | 192 | Iron superoxide dismutase; cold adaptation, flexib | 100.0 | |
| 1mng_A | 203 | Manganese superoxide dismutase; oxidoreductase(sup | 100.0 | |
| 3js4_A | 227 | Superoxide dismutase; niaid, ssgcid, seattle struc | 100.0 | |
| 2nyb_A | 192 | Superoxide dismutase [FE]; iron superoxide dismuta | 100.0 | |
| 1uer_A | 191 | SOD, superoxide dismutase; metal-specific, cambial | 100.0 | |
| 1dt0_A | 197 | Superoxide dismutase; pseudomonas ovalis, oxidored | 100.0 | |
| 3tqj_A | 210 | Superoxide dismutase [FE]; oxidoreductase; 2.00A { | 100.0 | |
| 3h1s_A | 195 | Superoxide dismutase; SOBD, csgid, oxidoreductase, | 100.0 | |
| 2gpc_A | 194 | Iron superoxide dismutase; alpha+beta structure, o | 100.0 | |
| 2rcv_A | 202 | Superoxide dismutase [MN]; bacillus subtilis,super | 100.0 | |
| 1xre_A | 217 | SODA-2, superoxide dismutase; spine, oxidoreductas | 100.0 | |
| 1gv3_A | 248 | Manganese superoxide dismutase; anabaena PCC 7120, | 100.0 | |
| 3kky_A | 211 | Mnsod, superoxide dismutase [MN]; manganese, ME bi | 100.0 | |
| 1unf_X | 238 | Iron superoxide dismutase; oxidoreductase, eukaryo | 100.0 | |
| 2awp_A | 198 | Iron super-oxide dismutase; structural genomics, s | 100.0 | |
| 3cei_A | 213 | Superoxide dismutase; oxidoreductase; 2.40A {Helic | 100.0 | |
| 4f2n_A | 230 | Superoxide dismutase; ssgcid, NIH, niaid, SBRI, em | 100.0 | |
| 3tjt_A | 208 | Superoxide dismutase; metal ION binding, rossmann | 100.0 | |
| 1ix9_A | 205 | Mnsod, superoxide dismutase; manganese superoxide | 100.0 | |
| 2cw2_A | 226 | Superoxide dismutase 1; SOD, oxidoreductase; 1.86A | 100.0 | |
| 4h3e_A | 241 | Fesod, superoxide dismutase; structural genomics, | 100.0 | |
| 1ids_A | 207 | Iron superoxide dismutase; 2.00A {Mycobacterium tu | 100.0 | |
| 4ffk_A | 223 | Superoxide dismutase; oxidoreductase, superoxide a | 100.0 | |
| 1bsm_A | 201 | Superoxide dismutase; oxidoreductase; 1.35A {Propi | 100.0 | |
| 3dc5_A | 195 | Superoxide dismutase [MN] 2; alpha hairpin N domai | 100.0 | |
| 1pl4_A | 198 | Superoxide dismutase [MN], mitochondrial; oxidored | 100.0 | |
| 1b06_A | 210 | Protein (superoxide dismutase); oxidoreductase; 2. | 100.0 | |
| 1ma1_A | 205 | Superoxide dismutase; metal specificity, azide inh | 100.0 | |
| 3ak2_A | 214 | Superoxide dismutase [MN/FE]; cambialistic, oxidor | 100.0 | |
| 1kkc_A | 221 | Mnsod, manganese superoxide dismutase; homotetrame | 100.0 | |
| 3qvn_A | 206 | Manganese-containing superoxide dismutase; Mn supe | 100.0 | |
| 3rn4_A | 215 | Superoxide dismutase [MN], mitochondrial; mitochon | 100.0 | |
| 2cw3_A | 280 | Pmsod2, iron superoxide dismutase; oxidoreductase; | 100.0 | |
| 1coj_A | 212 | Protein (superoxide dismutase); oxidoreductase; 1. | 100.0 |
| >1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=3.8e-61 Score=402.57 Aligned_cols=160 Identities=46% Similarity=0.758 Sum_probs=148.5
Q ss_pred chhhhccCCC-CCcchHHHHHHhh-HHHHHHHHHHHhccccCCCCCCCCCCCCCCHHHHHHHhhcCCCchhhhchhhHHh
Q 028580 13 TIWLTGQGLG-GRSTRLPFHWRNK-KMEQRKTGGRISAKFDLKPPPYPLLGDGKSLEDVVIASYNKGDLLPAFNNAAQAW 90 (207)
Q Consensus 13 ~~~~~~~~g~-lS~~~l~~H~~kh-~~YV~~LN~~l~~~~~~~~~~~~~~~~~~sl~~li~~~~~~~~~~~ifN~ag~~~ 90 (207)
.++|| + ||++||++||+|| |+||++||++++++ ++ +++++++|+......++.+.+||||||++
T Consensus 12 ~aLeP----~Gis~~tm~~Hh~kHh~~YV~~LN~~~~~~-~~---------~~~~~~~ii~~~~~~~~~~~i~nn~gg~~ 77 (199)
T 1my6_A 12 GALEP----YGMSAKTLEFHYGKHHKGYVDNLNKLTQDT-EL---------ADKSLEDVIRTTYGDAAKVGIFNNAAQVW 77 (199)
T ss_dssp TTTGG----GTCCHHHHHHHHHTHHHHHHHHHHHHHTTS-GG---------GGSCHHHHHHHHTTCTTCHHHHHHHHHHH
T ss_pred ccCCC----CCcCHHHHHHHHHHHHHHHHHHHHHHHcch-hh---------hcCCHHHHHHHhcccchhhhhhhHHHHHH
Confidence 67888 5 9999999999999 99999999999987 77 77899999876655455568999999999
Q ss_pred hHHHHHhhcCCCCCCCCcHHHHHHHHhhcCCHHHHHHHHHHHHhcCCCCeEEEEEEecCccccccccCCCCCCCCCCceE
Q 028580 91 NHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLL 170 (207)
Q Consensus 91 NH~ffw~~L~P~~~~~p~g~L~~~I~~~FGS~d~fk~~F~~~A~~~fGsGWvWLv~~~~~~l~~~~~~~~~~~~~~~~L~ 170 (207)
||+|||+||+|+++++|+|+|+++|+++|||||+||++|+++|.++|||||+|||+| +++|.
T Consensus 78 NH~~fw~~L~P~gg~~P~g~L~~aI~~~FGS~d~fk~~f~~aa~~~fGSGW~WLv~~------------------~g~L~ 139 (199)
T 1my6_A 78 NHTFFWNSLKPGGGGVPTGDVAARINSAFGSYDEFKAQFKNAAATQFGSGWAWLVLE------------------AGTLK 139 (199)
T ss_dssp HHHHHHHTBCTTCCSCCCHHHHHHHHHHHSSHHHHHHHHHHHHHHCCSSEEEEEEEE------------------TTEEE
T ss_pred HHHHHHHHhccCCCCCCCHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCeEEEEEEE------------------CCEEE
Confidence 999999999998777899999999999999999999999999999999999999998 37899
Q ss_pred EEeecCCCCCCCCCCeeeeEeccchhhhhhhccc
Q 028580 171 VVKTPNAVNPLVWDYSPLLTIDVWEVNIYHCVLV 204 (207)
Q Consensus 171 i~~t~n~~~p~~~~~~PLL~iDvWEHAYyldy~~ 204 (207)
|++|+||++|++.+.+||||||||||||||||+.
T Consensus 140 I~~t~n~~~p~~~g~~PlL~iDvWEHAYyldY~n 173 (199)
T 1my6_A 140 VTKTANAENPLVHGQVPLLTIDVWEHAYYLDYQN 173 (199)
T ss_dssp EEEEETTCCGGGGTCEEEEEEECSGGGTHHHHTT
T ss_pred EEeccCCCCCcccCCEeEEEEecchhhhHHHHCc
Confidence 9999999999999999999999999999999974
|
| >3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A | Back alignment and structure |
|---|
| >1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A | Back alignment and structure |
|---|
| >3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A | Back alignment and structure |
|---|
| >1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A | Back alignment and structure |
|---|
| >1dt0_A Superoxide dismutase; pseudomonas ovalis, oxidoreductase; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 | Back alignment and structure |
|---|
| >3tqj_A Superoxide dismutase [FE]; oxidoreductase; 2.00A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structura genomics; 1.90A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A | Back alignment and structure |
|---|
| >2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A | Back alignment and structure |
|---|
| >1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 | Back alignment and structure |
|---|
| >3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A | Back alignment and structure |
|---|
| >1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 | Back alignment and structure |
|---|
| >2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A | Back alignment and structure |
|---|
| >3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4f2n_A Superoxide dismutase; ssgcid, NIH, niaid, SBRI, emerald biostructures, structural national institute of allergy and infectious diseases; 1.85A {Leishmania major} | Back alignment and structure |
|---|
| >3tjt_A Superoxide dismutase; metal ION binding, rossmann fold, oxidoreductase; 1.80A {Clostridium difficile} | Back alignment and structure |
|---|
| >1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 3ot7_A 1en5_A 1en4_A 1i08_A 1en6_A | Back alignment and structure |
|---|
| >2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} | Back alignment and structure |
|---|
| >4h3e_A Fesod, superoxide dismutase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A | Back alignment and structure |
|---|
| >4ffk_A Superoxide dismutase; oxidoreductase, superoxide acceptor; 1.76A {Acidilobus saccharovorans} | Back alignment and structure |
|---|
| >1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichii subspshermanii} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A | Back alignment and structure |
|---|
| >3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A | Back alignment and structure |
|---|
| >1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... | Back alignment and structure |
|---|
| >1b06_A Protein (superoxide dismutase); oxidoreductase; 2.20A {Sulfolobus acidocaldarius} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A | Back alignment and structure |
|---|
| >1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 | Back alignment and structure |
|---|
| >3ak2_A Superoxide dismutase [MN/FE]; cambialistic, oxidoreductase; 1.35A {Aeropyrum pernix} PDB: 3ak1_A 3ak3_A 1p7g_A 3evk_A | Back alignment and structure |
|---|
| >1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 | Back alignment and structure |
|---|
| >3qvn_A Manganese-containing superoxide dismutase; Mn superoxide dismutase, oxidoreductase; 2.60A {Candida albicans} | Back alignment and structure |
|---|
| >3rn4_A Superoxide dismutase [MN], mitochondrial; mitochondrial manganese superoxide dismutase, iron-binding, mitochondrion, oxidoreductase; 1.79A {Saccharomyces cerevisiae} PDB: 3bfr_A 3lsu_A* 4e4e_A* | Back alignment and structure |
|---|
| >2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} | Back alignment and structure |
|---|
| >1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 207 | ||||
| d1unfx2 | 134 | d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSO | 2e-27 | |
| d1ma1a2 | 113 | d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD | 1e-20 | |
| d1my6a2 | 110 | d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD | 2e-19 | |
| d1mnga2 | 111 | d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD | 2e-19 | |
| d1gv3a2 | 111 | d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSO | 5e-19 | |
| d1wb8a2 | 116 | d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD | 2e-18 | |
| d1p7ga2 | 119 | d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSO | 5e-18 | |
| d1bsma2 | 115 | d.44.1.1 (A:87-201) Cambialistic superoxide dismut | 6e-18 | |
| d1jr9a2 | 111 | d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD | 1e-17 | |
| d2nyba2 | 110 | d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD | 3e-17 | |
| d1dt0a2 | 114 | d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD | 3e-17 | |
| d1idsa2 | 114 | d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD | 4e-17 | |
| d1coja2 | 122 | d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD | 5e-17 | |
| d1uera2 | 107 | d.44.1.1 (A:85-191) Cambialistic superoxide dismut | 6e-17 | |
| d1y67a2 | 116 | d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD | 4e-16 | |
| d2p4ka2 | 115 | d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD | 7e-16 | |
| d1kkca2 | 116 | d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD | 1e-15 | |
| d1ix9a2 | 115 | d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD | 1e-14 | |
| d1unfx1 | 91 | a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD | 8e-13 | |
| d1my6a1 | 88 | a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) | 2e-09 | |
| d1uera1 | 84 | a.2.11.1 (A:1-84) Cambialistic superoxide dismutas | 2e-08 | |
| d1ix9a1 | 90 | a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) | 1e-07 | |
| d1jr9a1 | 90 | a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) | 1e-07 | |
| d1gv3a1 | 102 | a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD | 1e-07 | |
| d1p7ga1 | 92 | a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD | 3e-07 | |
| d1mnga1 | 92 | a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) | 4e-07 | |
| d1bsma1 | 86 | a.2.11.1 (A:1-86) Cambialistic superoxide dismutas | 7e-07 | |
| d1ma1a1 | 88 | a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) | 2e-06 | |
| d2nyba1 | 82 | a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) | 2e-06 | |
| d1kkca1 | 84 | a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) | 3e-06 | |
| d1coja1 | 89 | a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) | 4e-06 | |
| d2p4ka1 | 83 | a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) | 7e-06 | |
| d1wb8a1 | 89 | a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) | 3e-05 | |
| d1idsa1 | 84 | a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) | 1e-04 |
| >d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Length = 134 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Fe,Mn superoxide dismutase (SOD), C-terminal domain superfamily: Fe,Mn superoxide dismutase (SOD), C-terminal domain family: Fe,Mn superoxide dismutase (SOD), C-terminal domain domain: Fe superoxide dismutase (FeSOD) species: Cowpea (Vigna unguiculata) [TaxId: 3917]
Score = 99.4 bits (247), Expect = 2e-27
Identities = 73/100 (73%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
Query: 102 GGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPL 161
GGGGKPSGELL LIERDFGSFEKFL+EFKAAAATQFGSGWAWL YKA+ D NA NP
Sbjct: 1 GGGGKPSGELLELIERDFGSFEKFLDEFKAAAATQFGSGWAWLAYKASKL-DGENAANPP 59
Query: 162 PSEKDKSLLVVKTPNAVNPLVWD-YSPLLTIDVWEVNIYH 200
+++D L+V+K+PNAVNPLVW Y PLLTIDVWE Y
Sbjct: 60 SADEDNKLVVIKSPNAVNPLVWGGYYPLLTIDVWEHAYYL 99
|
| >d1ma1a2 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 113 | Back information, alignment and structure |
|---|
| >d1my6a2 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Length = 110 | Back information, alignment and structure |
|---|
| >d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Length = 111 | Back information, alignment and structure |
|---|
| >d1gv3a2 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 116 | Back information, alignment and structure |
|---|
| >d1p7ga2 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 119 | Back information, alignment and structure |
|---|
| >d1bsma2 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Length = 115 | Back information, alignment and structure |
|---|
| >d1jr9a2 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Length = 111 | Back information, alignment and structure |
|---|
| >d2nyba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Length = 110 | Back information, alignment and structure |
|---|
| >d1dt0a2 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]} Length = 114 | Back information, alignment and structure |
|---|
| >d1idsa2 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 114 | Back information, alignment and structure |
|---|
| >d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Length = 122 | Back information, alignment and structure |
|---|
| >d1uera2 d.44.1.1 (A:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Length = 107 | Back information, alignment and structure |
|---|
| >d1y67a2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} Length = 116 | Back information, alignment and structure |
|---|
| >d2p4ka2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1kkca2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Length = 116 | Back information, alignment and structure |
|---|
| >d1ix9a2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Length = 115 | Back information, alignment and structure |
|---|
| >d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Length = 91 | Back information, alignment and structure |
|---|
| >d1my6a1 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Length = 88 | Back information, alignment and structure |
|---|
| >d1uera1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Length = 84 | Back information, alignment and structure |
|---|
| >d1ix9a1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Length = 90 | Back information, alignment and structure |
|---|
| >d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Length = 90 | Back information, alignment and structure |
|---|
| >d1gv3a1 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Length = 102 | Back information, alignment and structure |
|---|
| >d1p7ga1 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 92 | Back information, alignment and structure |
|---|
| >d1mnga1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Length = 92 | Back information, alignment and structure |
|---|
| >d1bsma1 a.2.11.1 (A:1-86) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Length = 86 | Back information, alignment and structure |
|---|
| >d1ma1a1 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 88 | Back information, alignment and structure |
|---|
| >d2nyba1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Length = 82 | Back information, alignment and structure |
|---|
| >d1kkca1 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Length = 84 | Back information, alignment and structure |
|---|
| >d1coja1 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Length = 89 | Back information, alignment and structure |
|---|
| >d2p4ka1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1wb8a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 89 | Back information, alignment and structure |
|---|
| >d1idsa1 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 84 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| d1wb8a2 | 116 | Fe superoxide dismutase (FeSOD) {Archaeon Sulfolob | 100.0 | |
| d1gv3a2 | 111 | Mn superoxide dismutase (MnSOD) {Anabaena sp. [Tax | 100.0 | |
| d1mnga2 | 111 | Mn superoxide dismutase (MnSOD) {Thermus thermophi | 100.0 | |
| d1ma1a2 | 113 | Fe superoxide dismutase (FeSOD) {Archaeon Methanob | 100.0 | |
| d1my6a2 | 110 | Fe superoxide dismutase (FeSOD) {Thermosynechococc | 100.0 | |
| d2nyba2 | 110 | Fe superoxide dismutase (FeSOD) {Escherichia coli | 100.0 | |
| d1idsa2 | 114 | Fe superoxide dismutase (FeSOD) {Mycobacterium tub | 100.0 | |
| d1uera2 | 107 | Cambialistic superoxide dismutase {Porphyromonas g | 100.0 | |
| d1p7ga2 | 119 | Fe superoxide dismutase (FeSOD) {Archaeon Pyrobacu | 100.0 | |
| d1bsma2 | 115 | Cambialistic superoxide dismutase {Propionibacteri | 100.0 | |
| d1jr9a2 | 111 | Mn superoxide dismutase (MnSOD) {Bacillus halodeni | 100.0 | |
| d1dt0a2 | 114 | Fe superoxide dismutase (FeSOD) {Pseudomonas ovali | 100.0 | |
| d1unfx2 | 134 | Fe superoxide dismutase (FeSOD) {Cowpea (Vigna ung | 100.0 | |
| d2p4ka2 | 115 | Mn superoxide dismutase (MnSOD) {Human (Homo sapie | 100.0 | |
| d1ix9a2 | 115 | Mn superoxide dismutase (MnSOD) {Escherichia coli | 100.0 | |
| d1y67a2 | 116 | Mn superoxide dismutase (MnSOD) {Deinococcus radio | 100.0 | |
| d1kkca2 | 116 | Mn superoxide dismutase (MnSOD) {Aspergillus fumig | 99.98 | |
| d1coja2 | 122 | Fe superoxide dismutase (FeSOD) {Aquifex pyrophilu | 99.97 | |
| d1my6a1 | 88 | Fe superoxide dismutase (FeSOD) {Thermosynechococc | 99.91 | |
| d1unfx1 | 91 | Fe superoxide dismutase (FeSOD) {Cowpea (Vigna ung | 99.89 | |
| d1uera1 | 84 | Cambialistic superoxide dismutase {Porphyromonas g | 99.89 | |
| d1mnga1 | 92 | Mn superoxide dismutase (MnSOD) {Thermus thermophi | 99.89 | |
| d2nyba1 | 82 | Fe superoxide dismutase (FeSOD) {Escherichia coli | 99.88 | |
| d1gv3a1 | 102 | Mn superoxide dismutase (MnSOD) {Anabaena sp. [Tax | 99.88 | |
| d1jr9a1 | 90 | Mn superoxide dismutase (MnSOD) {Bacillus halodeni | 99.88 | |
| d1ix9a1 | 90 | Mn superoxide dismutase (MnSOD) {Escherichia coli | 99.86 | |
| d1bsma1 | 86 | Cambialistic superoxide dismutase {Propionibacteri | 99.84 | |
| d1kkca1 | 84 | Mn superoxide dismutase (MnSOD) {Aspergillus fumig | 99.83 | |
| d1p7ga1 | 92 | Fe superoxide dismutase (FeSOD) {Archaeon Pyrobacu | 99.82 | |
| d1idsa1 | 84 | Fe superoxide dismutase (FeSOD) {Mycobacterium tub | 99.82 | |
| d2p4ka1 | 83 | Mn superoxide dismutase (MnSOD) {Human (Homo sapie | 99.82 | |
| d1ma1a1 | 88 | Fe superoxide dismutase (FeSOD) {Archaeon Methanob | 99.81 | |
| d1coja1 | 89 | Fe superoxide dismutase (FeSOD) {Aquifex pyrophilu | 99.8 | |
| d1wb8a1 | 89 | Fe superoxide dismutase (FeSOD) {Archaeon Sulfolob | 99.77 |
| >d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Fe,Mn superoxide dismutase (SOD), C-terminal domain superfamily: Fe,Mn superoxide dismutase (SOD), C-terminal domain family: Fe,Mn superoxide dismutase (SOD), C-terminal domain domain: Fe superoxide dismutase (FeSOD) species: Archaeon Sulfolobus solfataricus [TaxId: 2287]
Probab=100.00 E-value=9.6e-37 Score=233.46 Aligned_cols=86 Identities=31% Similarity=0.585 Sum_probs=81.5
Q ss_pred CCCCCcHHHHHHHHhhcCCHHHHHHHHHHHHhcCCCCeEEEEEEecCccccccccCCCCCCCCCCceEEEeecCCCCCCC
Q 028580 103 GGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLV 182 (207)
Q Consensus 103 ~~~~p~g~L~~~I~~~FGS~d~fk~~F~~~A~~~fGsGWvWLv~~~~~~l~~~~~~~~~~~~~~~~L~i~~t~n~~~p~~ 182 (207)
|+++|+++|+++|+++|||+|+||++|.++|.++|||||+|||+|+ .+++|.|+++.||++|++
T Consensus 5 Gg~~P~g~l~~~I~~~FGS~d~fk~~f~~~a~~~~GsGW~wLv~~~----------------~~~~l~i~~~~n~~~~~~ 68 (116)
T d1wb8a2 5 GGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDT----------------ESGNLQIMTFENHFQNHI 68 (116)
T ss_dssp BSSCCCHHHHHHHHHHHSSHHHHHHHHHHHHHTCCSSEEEEEEECT----------------TTCCEEEEEEETTTBSCC
T ss_pred CCCCCCHHHHHHHHHHhCCHHHHHHHHHHHHhcCcccceEEEEEeC----------------cCCcccccccccCCCCcc
Confidence 4568999999999999999999999999999999999999999995 468999999999999999
Q ss_pred CCCeeeeEeccchhhhhhhccc
Q 028580 183 WDYSPLLTIDVWEVNIYHCVLV 204 (207)
Q Consensus 183 ~~~~PLL~iDvWEHAYyldy~~ 204 (207)
.+..|||||||||||||+||+.
T Consensus 69 ~~~~piL~lDvWEHAYyldY~n 90 (116)
T d1wb8a2 69 AEIPIILILDEFEHAYYLQYKN 90 (116)
T ss_dssp SSCCEEEEEECSGGGTHHHHTT
T ss_pred CCCceeeeecchhhhhHHHHhc
Confidence 9999999999999999999983
|
| >d1gv3a2 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ma1a2 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1my6a2 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} | Back information, alignment and structure |
|---|
| >d2nyba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1idsa2 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uera2 d.44.1.1 (A:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1p7ga2 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1bsma2 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d1jr9a2 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} | Back information, alignment and structure |
|---|
| >d1dt0a2 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} | Back information, alignment and structure |
|---|
| >d2p4ka2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ix9a2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y67a2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1kkca2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} | Back information, alignment and structure |
|---|
| >d1my6a1 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} | Back information, alignment and structure |
|---|
| >d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} | Back information, alignment and structure |
|---|
| >d1uera1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1mnga1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2nyba1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gv3a1 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} | Back information, alignment and structure |
|---|
| >d1ix9a1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bsma1 a.2.11.1 (A:1-86) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d1kkca1 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1p7ga1 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1idsa1 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2p4ka1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ma1a1 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1coja1 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} | Back information, alignment and structure |
|---|
| >d1wb8a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|