Citrus Sinensis ID: 028603

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MDSDFWTSRLAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQALSLLGRDLREAHLQVLLGGSGYRSSNANISNAATDPFLSSLILNFPSSEAEEISKSVVTSTEDTSAKSAAPTHMWKTRYCFLAPMHT
ccHHHHHHHHHHHHHHHHHHHHHccccHHHHccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHcccccccccccHHHHccccHHHHHHHHHHHcccccccccccccccccccHHHHcccccccccHHHccccccccccccccccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccccHHHHHHcccccccccccEHHEHcccccccccccccccccHHHHHHcHcHHHHHHHHHHHHHHHHHHcccccccccccHHHHHccHHHHHHHHHHHccccccccccccccccccccccHHHcccccccccccccccccccccccccHcccccccccccccccccccc
MDSDFWTSRLAAAKRQYTLQQhhhqssqidrlsiddfeveddvrpdfpcpycyedfdiaslcshledehsceskvtvcpicsVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQALSLLGRDLREAHLQVLLGgsgyrssnanisnaatdpflsslilnfpsseaeeiSKSVVtstedtsaksaapthmwktrycflapmht
MDSDFWTSRLAAAKRQYTLqqhhhqssqidrlsIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLqhghlfklqrrRRLRRVAIPSSQALSLLGRDLREAHLQVLLGGSGYRSSNANISNAATDPFLSSLILNFPSSEAEEISKSvvtstedtsaksaapthmwKTRYCFLAPMHT
MDSDFWTSRLAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQrrrrlrrVAIPSSQALSLLGRDLREAHLQVLLGGSGYRSSNANISNAATDPFLSSLILNFPSSEAEEISKSVVTSTEDTSAKSAAPTHMWKTRYCFLAPMHT
******************************RLSIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQALSLLGRDLREAHLQVLLGGSGYR***********DPFLSSLILN****************************HMWKTRYCFLA****
**SDFW*SRLA**********************IDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGH*********************************************************LSSLIL*************************************FLAPMH*
MDSDFWTSRLAAAKR**************DRLSIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHL*********VTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQALSLLGRDLREAHLQVLLGGSGYRSSNANISNAATDPFLSSLILNFPSSE*********************PTHMWKTRYCFLAPMHT
*****WTSRLAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRR*********S**LSLLGRDLREAHLQVLLGG************AATDPFLSS*ILNFP*****************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSDFWTSRLAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQALSLLGRDLREAHLQVLLGGSGYRSSNANISNAATDPFLSSLILNFPSSEAEEISKSVVTSTEDTSAKSAAPTHMWKTRYCFLAPMHT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query206 2.2.26 [Sep-21-2011]
Q688X9226 Protein DEHYDRATION-INDUC yes no 0.917 0.836 0.553 1e-57
Q6H6E6245 Protein DEHYDRATION-INDUC no no 0.941 0.791 0.550 4e-48
Q5QMP3246 Protein DEHYDRATION-INDUC no no 0.946 0.792 0.478 2e-43
Q84J70223 Protein DEHYDRATION-INDUC yes no 0.757 0.699 0.434 9e-32
Q6NM26222 Protein DEHYDRATION-INDUC no no 0.752 0.698 0.428 1e-29
Q5W794233 Protein DEHYDRATION-INDUC no no 0.577 0.510 0.516 1e-29
Q39083206 Protein DEHYDRATION-INDUC no no 0.606 0.606 0.473 2e-29
Q9FJ17211 Protein DEHYDRATION-INDUC no no 0.733 0.715 0.415 1e-28
Q8VXU6224 Protein DEHYDRATION-INDUC no no 0.616 0.566 0.5 5e-24
O04259214 Protein DEHYDRATION-INDUC no no 0.708 0.682 0.317 7e-14
>sp|Q688X9|DI191_ORYSJ Protein DEHYDRATION-INDUCED 19 OS=Oryza sativa subsp. japonica GN=DI19-1 PE=2 SV=1 Back     alignment and function desciption
 Score =  222 bits (566), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 139/197 (70%), Gaps = 8/197 (4%)

Query: 1   MDSDFWTSRLAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIAS 60
           MDS+ W SRLAAAKR Y  Q  H      DR  +++ +++++VRP+F CPYCYED D+ S
Sbjct: 1   MDSEHWISRLAAAKRFYAAQLGH-----ADRAGMEEVDMDEEVRPEFACPYCYEDHDVVS 55

Query: 61  LCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQAL 120
           LC+HLE+EH  E     CPICS K+A+DML+HIT+QHG+LFK   RRRLRR  IP SQAL
Sbjct: 56  LCAHLEEEHPFEPHAAPCPICSDKIAKDMLNHITVQHGYLFK--NRRRLRRFVIPGSQAL 113

Query: 121 SLLGRDLREAHLQVLLGGSGYRSSN-ANISNAATDPFLSSLILNFPSSEAEEISKSVVTS 179
           SLL RDLREAHLQVLLGG G+RS+N +N +N + DP LSS  L+FP+S+ EE SK  ++ 
Sbjct: 114 SLLSRDLREAHLQVLLGGGGHRSNNSSNTTNISADPLLSSFGLSFPTSDTEETSKPPISI 173

Query: 180 TEDTSAKSAAPTHMWKT 196
            +D S     P   W +
Sbjct: 174 PDDASVIKETPAQPWDS 190

Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q6H6E6|DI194_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 4 OS=Oryza sativa subsp. japonica GN=DI19-4 PE=2 SV=1 Back     alignment and function description
>sp|Q5QMP3|DI193_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 3 OS=Oryza sativa subsp. japonica GN=DI19-3 PE=2 SV=1 Back     alignment and function description
>sp|Q84J70|DI193_ARATH Protein DEHYDRATION-INDUCED 19 homolog 3 OS=Arabidopsis thaliana GN=DI19-3 PE=1 SV=1 Back     alignment and function description
>sp|Q6NM26|DI196_ARATH Protein DEHYDRATION-INDUCED 19 homolog 6 OS=Arabidopsis thaliana GN=DI19-6 PE=1 SV=1 Back     alignment and function description
>sp|Q5W794|DI192_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 2 OS=Oryza sativa subsp. japonica GN=DI19-2 PE=2 SV=2 Back     alignment and function description
>sp|Q39083|DI191_ARATH Protein DEHYDRATION-INDUCED 19 OS=Arabidopsis thaliana GN=DI19-1 PE=1 SV=2 Back     alignment and function description
>sp|Q9FJ17|DI197_ARATH Protein DEHYDRATION-INDUCED 19 homolog 7 OS=Arabidopsis thaliana GN=DI19-7 PE=1 SV=2 Back     alignment and function description
>sp|Q8VXU6|DI194_ARATH Protein DEHYDRATION-INDUCED 19 homolog 4 OS=Arabidopsis thaliana GN=DI19-4 PE=1 SV=1 Back     alignment and function description
>sp|O04259|DI195_ARATH Protein DEHYDRATION-INDUCED 19 homolog 5 OS=Arabidopsis thaliana GN=DI19-5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
255536745231 conserved hypothetical protein [Ricinus 0.956 0.852 0.873 1e-94
225443618231 PREDICTED: protein DEHYDRATION-INDUCED 1 0.956 0.852 0.823 7e-86
217075142234 unknown [Medicago truncatula] gi|3884911 0.956 0.841 0.756 3e-80
356521402233 PREDICTED: protein DEHYDRATION-INDUCED 1 0.956 0.845 0.805 1e-77
224125558268 predicted protein [Populus trichocarpa] 0.946 0.727 0.711 4e-75
356548672237 PREDICTED: protein DEHYDRATION-INDUCED 1 0.956 0.831 0.784 9e-75
118483033180 unknown [Populus trichocarpa] 0.849 0.972 0.842 1e-72
388508052176 unknown [Medicago truncatula] 0.825 0.965 0.790 2e-71
192910804230 fiber protein Fb2 [Elaeis guineensis] 0.941 0.843 0.704 2e-66
294463922229 unknown [Picea sitchensis] 0.927 0.834 0.656 8e-65
>gi|255536745|ref|XP_002509439.1| conserved hypothetical protein [Ricinus communis] gi|223549338|gb|EEF50826.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 188/198 (94%), Gaps = 1/198 (0%)

Query: 1   MDSDFWTSRLAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIAS 60
           MDSDFWTSR+AAAKRQYTLQ HHHQS  +DRL+IDDFEVED+VRPDFPCPYCYEDFDI S
Sbjct: 1   MDSDFWTSRIAAAKRQYTLQ-HHHQSYHLDRLNIDDFEVEDEVRPDFPCPYCYEDFDITS 59

Query: 61  LCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQAL 120
           LCSHLEDEHSCES+VTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIP+SQAL
Sbjct: 60  LCSHLEDEHSCESRVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPNSQAL 119

Query: 121 SLLGRDLREAHLQVLLGGSGYRSSNANISNAATDPFLSSLILNFPSSEAEEISKSVVTST 180
           SLLGRDLREAHLQ+LLGG GYRS+N N+SNAATDPFLSSLILNFP+SEAEEISKSVVTS 
Sbjct: 120 SLLGRDLREAHLQMLLGGGGYRSNNGNVSNAATDPFLSSLILNFPTSEAEEISKSVVTSV 179

Query: 181 EDTSAKSAAPTHMWKTRY 198
           ED  AK+AAPT+MW++ +
Sbjct: 180 EDAPAKTAAPTNMWRSSF 197

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225443618|ref|XP_002279435.1| PREDICTED: protein DEHYDRATION-INDUCED 19-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|217075142|gb|ACJ85931.1| unknown [Medicago truncatula] gi|388491118|gb|AFK33625.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356521402|ref|XP_003529345.1| PREDICTED: protein DEHYDRATION-INDUCED 19-like [Glycine max] Back     alignment and taxonomy information
>gi|224125558|ref|XP_002329834.1| predicted protein [Populus trichocarpa] gi|222870896|gb|EEF08027.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356548672|ref|XP_003542724.1| PREDICTED: protein DEHYDRATION-INDUCED 19-like [Glycine max] Back     alignment and taxonomy information
>gi|118483033|gb|ABK93427.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388508052|gb|AFK42092.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|192910804|gb|ACF06510.1| fiber protein Fb2 [Elaeis guineensis] Back     alignment and taxonomy information
>gi|294463922|gb|ADE77482.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
TAIR|locus:2078062223 AT3G05700 [Arabidopsis thalian 0.757 0.699 0.409 5.6e-29
TAIR|locus:2148528222 AT5G26990 [Arabidopsis thalian 0.859 0.797 0.397 7.1e-29
TAIR|locus:2155934211 HRB1 "HYPERSENSITIVE TO RED AN 0.844 0.824 0.372 5.3e-24
TAIR|locus:2196125221 AT1G02750 [Arabidopsis thalian 0.485 0.452 0.346 3.7e-16
TAIR|locus:2083363234 AT3G06760 [Arabidopsis thalian 0.194 0.170 0.525 1.1e-15
TAIR|locus:2137819228 AT4G02200 [Arabidopsis thalian 0.708 0.640 0.292 1e-13
UNIPROTKB|I3LV30181 RNF114 "RING finger protein 11 0.189 0.215 0.5 0.00049
UNIPROTKB|Q4U5R4230 RNF114 "RING finger protein 11 0.189 0.169 0.5 0.00061
MGI|MGI:1933159229 Rnf114 "ring finger protein 11 0.189 0.170 0.5 0.0008
RGD|1303139229 Rnf114 "ring finger protein 11 0.189 0.170 0.5 0.0008
TAIR|locus:2078062 AT3G05700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 322 (118.4 bits), Expect = 5.6e-29, P = 5.6e-29
 Identities = 66/161 (40%), Positives = 97/161 (60%)

Query:     1 MDSDFWTSRLAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIAS 60
             MDSD W+ RLA+A R+Y L      S     L  ++ + E++ R +F CP+C + FDI S
Sbjct:     1 MDSDSWSDRLASATRRYQLA---FPSRSDTFLGFEEIDGEEEFREEFACPFCSDYFDIVS 57

Query:    61 LCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQXXXXXXXVAIPSSQAL 120
             LC H++++H  E+K  VCP+C+V+V  DM++HITLQH ++FK+            S   L
Sbjct:    58 LCCHIDEDHPMEAKNGVCPVCAVRVGVDMVAHITLQHANIFKMHRKRKPRRGG--SYSTL 115

Query:   121 SLLGRDLREAHLQVLLGGSGYRSSNANISNAATDPFLSSLI 161
             S+L R+  + + Q L GGS    S+++ SN A DP LSS I
Sbjct:   116 SILRREFPDGNFQSLFGGSSCIVSSSSSSNVAADPLLSSFI 156
GO:0005634 "nucleus" evidence=ISM
GO:0009414 "response to water deprivation" evidence=ISS
TAIR|locus:2148528 AT5G26990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155934 HRB1 "HYPERSENSITIVE TO RED AND BLUE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196125 AT1G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083363 AT3G06760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137819 AT4G02200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I3LV30 RNF114 "RING finger protein 114" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q4U5R4 RNF114 "RING finger protein 114" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1933159 Rnf114 "ring finger protein 114" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1303139 Rnf114 "ring finger protein 114" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q688X9DI191_ORYSJNo assigned EC number0.55320.91740.8362yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_1240071
hypothetical protein (268 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
pfam05605209 pfam05605, Di19, Drought induced 19 protein (Di19) 3e-66
>gnl|CDD|218654 pfam05605, Di19, Drought induced 19 protein (Di19) Back     alignment and domain information 
 Score =  202 bits (515), Expect = 3e-66
 Identities = 90/187 (48%), Positives = 121/187 (64%), Gaps = 7/187 (3%)

Query: 10  LAAAKRQYTLQQHHHQSSQIDRLSIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEH 69
            A+A   Y            D    +D E ED+VR +FPCP+CYEDFDI SLC H+++EH
Sbjct: 1   HASASASYQRALPSRS----DLYLFEDIEGEDEVREEFPCPFCYEDFDIVSLCCHIDEEH 56

Query: 70  SCESKVTVCPICSVKVARDMLSHITLQHGHLFKLQRRRRLRRVAIPSSQALSLLGRDLRE 129
             E+K  VCP+C+ +V +DM++HIT+QHGHLFK+QRRRRLRR    SS ALSLL R+LR+
Sbjct: 57  PFEAKNGVCPVCADRVGKDMVAHITVQHGHLFKMQRRRRLRR--GGSSSALSLLKRELRD 114

Query: 130 AHLQVLLGGSGYRSSNANISNAATDPFLSSLILNFPSSEAEEISKSVVTSTEDTSAKSAA 189
            +LQ LLG S   SS++N S++A DP LSS I + PS++    SKS  ++    SAKS+ 
Sbjct: 115 GNLQSLLGSS-CMSSSSNASDSAPDPLLSSFICSSPSADTSSTSKSDSSTEGSASAKSSD 173

Query: 190 PTHMWKT 196
                + 
Sbjct: 174 QKLSERN 180

This family consists of several drought induced 19 (Di19) like proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought. The precise function of Di19 is unknown. Length = 209

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 206
PF14571105 Di19_C: Stress-induced protein Di19, C-terminal 99.89
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 99.8
KOG1280 381 consensus Uncharacterized conserved protein contai 98.59
KOG292367 consensus Uncharacterized conserved protein [Funct 94.85
COG521667 Uncharacterized conserved protein [Function unknow 94.69
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 94.31
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 93.76
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.38
PLN03086567 PRLI-interacting factor K; Provisional 92.1
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 91.6
PHA0073279 hypothetical protein 89.77
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 89.66
smart00531147 TFIIE Transcription initiation factor IIE. 89.08
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 88.65
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 87.86
PHA00733128 hypothetical protein 87.49
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 87.31
PF1435461 Lar_restr_allev: Restriction alleviation protein L 86.56
PRK0971064 lar restriction alleviation and modification prote 86.26
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 85.79
PLN03086567 PRLI-interacting factor K; Provisional 85.02
PHA0276855 hypothetical protein; Provisional 83.88
COG5236493 Uncharacterized conserved protein, contains RING Z 83.66
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 83.16
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 81.93
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 81.85
smart0050463 Ubox Modified RING finger domain. Modified RING fi 81.19
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 80.74
>PF14571 Di19_C: Stress-induced protein Di19, C-terminal Back     alignment and domain information 
Probab=99.89  E-value=6.9e-24  Score=165.36  Aligned_cols=78  Identities=53%  Similarity=0.674  Sum_probs=71.3

Q ss_pred             hHhhhchhhhhhhhhhhhCCCCCCCCCCCCCCCCCCchhhhhccCCCCCchhhhcccccCccccccccccCCcCCccccc
Q 028603          119 ALSLLGRDLREAHLQVLLGGSGYRSSNANISNAATDPFLSSLILNFPSSEAEEISKSVVTSTEDTSAKSAAPTHMWKTRY  198 (206)
Q Consensus       119 ~ls~l~k~lre~~lq~llgg~~~~~~~~~~s~~~pDPLLSsFi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~  198 (206)
                      |||+|+|||||||||+||||+  ++++++++|++|||||||||||+|.++.++.+++..++.++++.++..+.+.|++++
T Consensus         1 tlsll~kelre~~LQsllGgs--~~~~~~ssn~apDPLLSSFI~n~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~s~   78 (105)
T PF14571_consen    1 TLSLLRKELREGYLQSLLGGS--RSSSSSSSNSAPDPLLSSFICNFPAPEAEEPSKSSSSSEEKKSSKKSSSEQNVKSSA   78 (105)
T ss_pred             CcchhhhhhhhhhhhhhcCCC--cCCCCCCCCCCCcHHHHHHhcCCCCccccccCCccccccccccccccchhccccccc
Confidence            689999999999999999998  455678999999999999999999999999999888888899999999999999765

>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2923 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5216 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 97.47
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 97.47
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 96.93
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 96.83
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 96.68
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 96.65
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 96.56
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 96.54
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 96.43
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 96.36
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 96.27
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 96.25
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 96.11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 96.02
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 96.01
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 96.0
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 95.98
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 95.93
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 95.9
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 95.89
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 95.76
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 95.76
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 95.73
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 95.66
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 95.61
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 95.6
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 95.59
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 95.53
2lv2_A85 Insulinoma-associated protein 1; structural genomi 95.46
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 95.39
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 95.24
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 95.07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 95.04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 94.87
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 94.73
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.63
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 94.56
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 94.39
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.37
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.33
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 94.32
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 94.27
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.24
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.18
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 94.14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 94.08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.02
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 93.96
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.93
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 93.85
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 93.85
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.85
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 93.84
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.84
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 93.83
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.73
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 93.66
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.65
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 93.64
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.61
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.6
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 93.58
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 93.56
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 93.54
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.52
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 93.49
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 93.45
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 93.43
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 93.4
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 93.37
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.3
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 93.21
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 93.21
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 93.19
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 93.16
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 93.15
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 93.13
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 92.96
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 92.93
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 92.87
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 92.73
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 92.67
1tf6_A190 Protein (transcription factor IIIA); complex (tran 92.63
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 92.53
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 92.53
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 92.5
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 92.47
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 92.46
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 92.44
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 92.42
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 92.4
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 92.32
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 92.31
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 92.25
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 92.2
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 92.13
1wge_A83 Hypothetical protein 2610018L09RIK; diphthamide,CS 92.11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 92.1
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 92.05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 92.02
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 91.97
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 91.9
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 91.86
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 91.84
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 91.73
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 91.59
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 91.52
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 91.46
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 91.46
2jr7_A89 DPH3 homolog; DESR1, CSL zinc finger, metal bindin 91.41
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 90.95
2ysl_A73 Tripartite motif-containing protein 31; ring-type 90.89
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 90.42
1yop_A83 KTI11P; zinc finger, metal binding protein; NMR {S 90.35
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 90.04
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 89.66
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 89.66
1vd4_A62 Transcription initiation factor IIE, alpha subunit 89.5
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 89.34
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 88.84
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 88.65
2epa_A72 Krueppel-like factor 10; transforming growth facto 88.53
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 88.48
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 88.25
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.11
1tf6_A190 Protein (transcription factor IIIA); complex (tran 87.89
1paa_A30 Yeast transcription factor ADR1; transcription reg 87.87
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 87.62
2f42_A179 STIP1 homology and U-box containing protein 1; cha 87.09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.97
2ysj_A63 Tripartite motif-containing protein 31; ring-type 86.67
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 86.63
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.37
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.23
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.19
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 86.07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 86.0
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 85.93
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.61
2lv2_A85 Insulinoma-associated protein 1; structural genomi 85.54
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 85.53
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 85.45
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 85.34
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.28
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.21
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 84.79
2ecw_A85 Tripartite motif-containing protein 30; metal bind 84.55
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 84.48
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 84.46
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 84.35
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 84.22
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.93
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 83.91
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 83.71
1ard_A29 Yeast transcription factor ADR1; transcription reg 83.35
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 83.33
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 83.23
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 83.14
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 82.66
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 82.31
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 82.27
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 82.26
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 82.11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 81.91
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 81.84
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 81.32
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 81.11
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 80.57
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 80.47
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 80.27
2ect_A78 Ring finger protein 126; metal binding protein, st 80.23
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.07
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
Probab=97.47  E-value=0.00013  Score=49.38  Aligned_cols=54  Identities=20%  Similarity=0.404  Sum_probs=46.3

Q ss_pred             cccCCCCCC-CCCHHHHHHHhhhhccCCCCceecCccccch--hhhHhhhhhccccc
Q 028603           46 DFPCPYCYE-DFDIASLCSHLEDEHSCESKVTVCPICSVKV--ARDMLSHITLQHGH   99 (206)
Q Consensus        46 ~F~CPfC~e-~fD~~~L~~H~~eeH~~e~k~vVCPICa~~v--s~d~l~HL~~qH~~   99 (206)
                      .|.|++|+. =.....|..|+...|..+.+.-.|++|...-  ..+|..|+...|+.
T Consensus        15 ~~~C~~C~k~f~~~~~L~~H~~~~h~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~   71 (77)
T 2ct1_A           15 PYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSY   71 (77)
T ss_dssp             SEECTTTCCEESCHHHHHHHHHHHSSSSCSSEECSSSSCEESSHHHHHHHHHHTSCC
T ss_pred             CeECCCcCchhCCHHHHHHHHHHhcCCCCCccCCCCCCCccCCHHHHHHHHHHhCCC
Confidence            599999999 5567899999998898777788999998864  56899999988865
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
d1wgea170 DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus 94.31
d1ywsa182 Diphthamide biosynthesis protein 3, DPH3 {Baker's 92.69
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 91.8
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.66
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 90.99
d2c2la280 STIP1 homology and U box-containing protein 1, STU 90.95
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 90.94
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 89.49
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 87.65
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 86.81
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 85.16
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 84.0
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 82.61
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 82.34
d2ct5a160 Zinc finger BED domain-containing protein 1 {Human 81.26
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 80.06
>d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: CSL zinc finger
family: CSL zinc finger
domain: DelGEF-interacting protein 1, DelGIP1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=94.31  E-value=0.0071  Score=42.05  Aligned_cols=47  Identities=32%  Similarity=0.756  Sum_probs=31.5

Q ss_pred             cccCCCCCCCCCC-CCCcccCCCCCC--CCCHHHHHHHhhhhccCCCCceecCccccch
Q 028603           30 DRLSIDDFEVEDD-VRPDFPCPYCYE--DFDIASLCSHLEDEHSCESKVTVCPICSVKV   85 (206)
Q Consensus        30 ~~~~~d~~e~ddd-~r~~F~CPfC~e--~fD~~~L~~H~~eeH~~e~k~vVCPICa~~v   85 (206)
                      |.+.+||++-|+| ..-+|+|| ||.  .+....|-++        .-.+.||-|+-.+
T Consensus         6 dev~leD~~~dee~~~~~ypCp-CGd~F~it~~dLe~g--------e~V~~C~sCSL~i   55 (70)
T d1wgea1           6 DEVEIEDFQYDEDSETYFYPCP-CGDNFAITKEDLENG--------EDVATCPSCSLII   55 (70)
T ss_dssp             CEEEGGGSCCBTTTTEEEECCS-SSSCEEEEHHHHHTT--------CCEEECTTTCCEE
T ss_pred             EEEEeeeeeEeCCCCEEEeCCC-CCCeEEECHHHHhCC--------CeEEeCCCCceEE
Confidence            3455677665444 34689999 999  5666666542        2246799999876
>d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct5a1 g.37.1.6 (A:8-67) Zinc finger BED domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure