Citrus Sinensis ID: 028638


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MLKMTKTLCTRSSGGDLRYCQKCSHYKPPRAHHCRVCKRCVLRMDHHCIWISNCVGHANYKVFFIFVLYAVVACIYSMVLLVGSLTNDSLEDELQTGGSFRTAYVISGLLLVPLSVALSVLLGWHIYLIFHNKTTIEYHEGVRALWLAEKGGTVYKHPYDLGIFENLTSVLGPNIFSWVCPSSRHIGSGLNFRTAYHNAVGASMSK
ccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccEEEcccccccccCEEEccccccccccccc
**KMTKT***RSSGGDLRYCQKCSHYKPPRAHHCRVCKRCVLRMDHHCIWISNCVGHANYKVFFIFVLYAVVACIYSMVLLVGSLTNDSLEDELQTGGSFRTAYVISGLLLVPLSVALSVLLGWHIYLIFHNKTTIEYHEGVRALWLAEKGGTVYKHPYDLGIFENLTSVLGPNIFSWVCPSSRHIGSGLNFRTA***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKMTKTLCTRSSGGDLRYCQKCSHYKPPRAHHCRVCKRCVLRMDHHCIWISNCVGHANYKVFFIFVLYAVVACIYSMVLLVGSLTNDSLEDELQTGGSFRTAYVISGLLLVPLSVALSVLLGWHIYLIFHNKTTIEYHEGVRALWLAEKGGTVYKHPYDLGIFENLTSVLGPNIFSWVCPSSRHIGSGLNFRTAYHNAVGASMSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable S-acyltransferase At3g09320 probableQ93VV0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3J21, chain g
Confidence level:probable
Coverage over the Query: 12-40
View the alignment between query and template
View the model in PyMOL
Template: 2KNC, chain B
Confidence level:probable
Coverage over the Query: 105-144
View the alignment between query and template
View the model in PyMOL