Citrus Sinensis ID: 028654

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKTDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAAFECIAKNALKNEPQEEDYLPDTIDVGGGQQQRSSGCEC
cccccccEEEEEEEccccccHHHHHHHHHHccccccccccccEEEEccEEEEccEEEEEEEEEcccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHHHccccccccccccCCcccccccccccccc
***RRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKTDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAAFECIAKNA******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKTDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAAFECIAKNALKNEPQEEDYLPDTIDVGGGQQQRSSGCEC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein RABG3d Intracellular vesicle trafficking and protein transport.confidentQ9C820
Ras-related protein Rab7 Protein transport. Probably involved in vesicular traffic.confidentQ40787
Ras-related protein Rab-7A confidentP36411

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VG8, chain A
Confidence level:very confident
Coverage over the Query: 7-191
View the alignment between query and template
View the model in PyMOL