Citrus Sinensis ID: 028665
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 205 | ||||||
| 225450073 | 365 | PREDICTED: 42 kDa peptidyl-prolyl isomer | 0.990 | 0.556 | 0.833 | 7e-94 | |
| 255645857 | 370 | unknown [Glycine max] | 0.995 | 0.551 | 0.790 | 7e-90 | |
| 356531669 | 370 | PREDICTED: 42 kDa peptidyl-prolyl isomer | 0.995 | 0.551 | 0.790 | 7e-90 | |
| 449464000 | 369 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.980 | 0.544 | 0.802 | 2e-89 | |
| 449516701 | 369 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.980 | 0.544 | 0.798 | 6e-89 | |
| 356542700 | 370 | PREDICTED: 42 kDa peptidyl-prolyl isomer | 0.995 | 0.551 | 0.785 | 4e-88 | |
| 224104085 | 369 | predicted protein [Populus trichocarpa] | 0.951 | 0.528 | 0.805 | 5e-88 | |
| 224059618 | 372 | predicted protein [Populus trichocarpa] | 0.990 | 0.545 | 0.779 | 2e-87 | |
| 118138347 | 338 | Chain A, Crystal Structure Of A Multi-Do | 0.912 | 0.553 | 0.812 | 6e-86 | |
| 30686321 | 365 | peptidyl-prolyl isomerase [Arabidopsis t | 0.912 | 0.512 | 0.812 | 2e-85 |
| >gi|225450073|ref|XP_002277668.1| PREDICTED: 42 kDa peptidyl-prolyl isomerase isoform 2 [Vitis vinifera] gi|225450075|ref|XP_002277645.1| PREDICTED: 42 kDa peptidyl-prolyl isomerase isoform 1 [Vitis vinifera] gi|297736282|emb|CBI24920.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 348 bits (893), Expect = 7e-94, Method: Compositional matrix adjust.
Identities = 170/204 (83%), Positives = 187/204 (91%), Gaps = 1/204 (0%)
Query: 1 MEEVDGEPKSQAPGEVGESEIVTEDAAFVRGEPPQDGDGPPKVDSEVEVLHEKVTKQIIK 60
ME+V+ E +SQ P + E+EIVTE+AAFV GEP QDG GPPKVDSEVEVLHEKVTKQI+K
Sbjct: 1 MEDVE-ELQSQKPDQDDENEIVTENAAFVHGEPLQDGTGPPKVDSEVEVLHEKVTKQIMK 59
Query: 61 EGHGQKPSKYSTCFLHYRAWAESTRHKFDDTWLEQQPLEMVLGKEKKEMTGLAIGVSSMK 120
EGHGQKPSKYSTCFLHYRAW EST+HKF+DTW EQ+P+E+V+GKEKKEMTGLAIGVS+MK
Sbjct: 60 EGHGQKPSKYSTCFLHYRAWTESTQHKFEDTWNEQRPVEIVIGKEKKEMTGLAIGVSNMK 119
Query: 121 AGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIG 180
+GE ALLHVGWELGYGKEGSFSFPNV PMAD++YEV LIGFDETKEGKAR DMTVEERIG
Sbjct: 120 SGERALLHVGWELGYGKEGSFSFPNVPPMADILYEVELIGFDETKEGKARGDMTVEERIG 179
Query: 181 AADRRKMDGNALFKEEKLEEAMQQ 204
AADRRKMDGN FKEEKLEEAMQQ
Sbjct: 180 AADRRKMDGNVYFKEEKLEEAMQQ 203
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255645857|gb|ACU23419.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531669|ref|XP_003534399.1| PREDICTED: 42 kDa peptidyl-prolyl isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449464000|ref|XP_004149717.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP42-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449516701|ref|XP_004165385.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP42-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356542700|ref|XP_003539804.1| PREDICTED: 42 kDa peptidyl-prolyl isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224104085|ref|XP_002313312.1| predicted protein [Populus trichocarpa] gi|118485759|gb|ABK94729.1| unknown [Populus trichocarpa] gi|222849720|gb|EEE87267.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224059618|ref|XP_002299936.1| predicted protein [Populus trichocarpa] gi|222847194|gb|EEE84741.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|118138347|pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana | Back alignment and taxonomy information |
|---|
| >gi|30686321|ref|NP_188801.2| peptidyl-prolyl isomerase [Arabidopsis thaliana] gi|75334844|sp|Q9LDC0.1|FKB42_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP42; Short=PPIase FKBP42; AltName: Full=42 kDa peptidyl-prolyl isomerase; AltName: Full=FK506-binding protein 42; Short=AtFKBP42; AltName: Full=Immunophilin FKBP42; AltName: Full=Protein TWISTED DWARF 1; AltName: Full=Protein ULTRACURVATA 2; AltName: Full=Rotamase gi|9650631|emb|CAC00654.1| FKBP-like [Arabidopsis thaliana] gi|11994400|dbj|BAB02359.1| unnamed protein product [Arabidopsis thaliana] gi|332643012|gb|AEE76533.1| peptidyl-prolyl isomerase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 205 | ||||||
| TAIR|locus:2089890 | 365 | TWD1 "AT3G21640" [Arabidopsis | 0.912 | 0.512 | 0.812 | 4.1e-81 | |
| UNIPROTKB|Q2QXS0 | 370 | LOC_Os12g05090 "Os12g0145500 p | 0.960 | 0.532 | 0.690 | 4e-74 | |
| GENEDB_PFALCIPARUM|PFL2275c | 304 | PfFKBP35 "FK506-binding protei | 0.697 | 0.470 | 0.339 | 3.4e-12 | |
| UNIPROTKB|Q8I4V8 | 304 | FKBP35 "FK506-binding protein | 0.697 | 0.470 | 0.339 | 3.4e-12 | |
| UNIPROTKB|Q6K5Q1 | 682 | P0579G08.8 "Putative peptidylp | 0.619 | 0.186 | 0.311 | 5.3e-12 | |
| UNIPROTKB|Q7RM28 | 306 | PY02360 "FK506-binding protein | 0.697 | 0.467 | 0.339 | 1e-11 | |
| TAIR|locus:2152561 | 578 | ROF2 "AT5G48570" [Arabidopsis | 0.751 | 0.266 | 0.325 | 1.6e-11 | |
| ZFIN|ZDB-GENE-050302-4 | 343 | fkbp6 "FK506 binding protein 6 | 0.721 | 0.431 | 0.270 | 3.9e-10 | |
| TAIR|locus:2090265 | 562 | ROF1 "AT3G25230" [Arabidopsis | 0.834 | 0.304 | 0.291 | 4.8e-10 | |
| UNIPROTKB|Q7F1F2 | 580 | OJ1191_A10.119 "cDNA clone:J03 | 0.609 | 0.215 | 0.305 | 7e-09 |
| TAIR|locus:2089890 TWD1 "AT3G21640" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 814 (291.6 bits), Expect = 4.1e-81, P = 4.1e-81
Identities = 152/187 (81%), Positives = 171/187 (91%)
Query: 18 ESEIVTEDAAFVRGEPPQDGDGPPKVDSEVEVLHEKVTKQIIKEGHGQKPSKYSTCFLHY 77
ESEIVTE +A V EP Q+G+ PPKVDSE EVL EKV+KQIIKEGHG KPSKYSTCFLHY
Sbjct: 15 ESEIVTEGSAVVHSEPSQEGNVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHY 74
Query: 78 RAWAESTRHKFDDTWLEQQPLEMVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGK 137
RAW ++++HKF+DTW EQQP+E+VLGKEKKE+ GLAIGV+SMK+GE AL+HVGWEL YGK
Sbjct: 75 RAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGK 134
Query: 138 EGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEK 197
EG+FSFPNV PMADL+YEV +IGFDETKEGKARSDMTVEERIGAADRRKMDGN+LFKEEK
Sbjct: 135 EGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEK 194
Query: 198 LEEAMQQ 204
LEEAMQQ
Sbjct: 195 LEEAMQQ 201
|
|
| UNIPROTKB|Q2QXS0 LOC_Os12g05090 "Os12g0145500 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PFL2275c PfFKBP35 "FK506-binding protein (FKBP)-type peptidyl-propyl isomerase" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8I4V8 FKBP35 "FK506-binding protein (FKBP)-type peptidyl-propyl isomerase" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6K5Q1 P0579G08.8 "Putative peptidylprolyl isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7RM28 PY02360 "FK506-binding protein" [Plasmodium yoelii yoelii (taxid:73239)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152561 ROF2 "AT5G48570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050302-4 fkbp6 "FK506 binding protein 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090265 ROF1 "AT3G25230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7F1F2 OJ1191_A10.119 "cDNA clone:J033121G16, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 205 | |||
| pfam00254 | 94 | pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t | 2e-13 | |
| COG0545 | 205 | COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans | 1e-09 |
| >gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase | Back alignment and domain information |
|---|
Score = 63.0 bits (154), Expect = 2e-13
Identities = 32/94 (34%), Positives = 43/94 (45%), Gaps = 3/94 (3%)
Query: 66 KPSKYSTCFLHYRAWAESTRHKFDDTWLEQQPLEMVLGKEKKEMTGLAIGVSSMKAGEHA 125
K K T +HY E FD + +P E LG + + G G+ MK GE
Sbjct: 4 KAKKGDTVTVHYTGKLEDGT-VFDSSKDRGKPFEFTLGSGQV-IPGWDEGLLGMKVGEKR 61
Query: 126 LLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLI 159
L + EL YG+EG + P A LV+EV L+
Sbjct: 62 KLTIPPELAYGEEGLAG-GVIPPNATLVFEVELL 94
|
Length = 94 |
| >gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 205 | |||
| COG0545 | 205 | FkpA FKBP-type peptidyl-prolyl cis-trans isomerase | 100.0 | |
| KOG0544 | 108 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.97 | |
| PRK11570 | 206 | peptidyl-prolyl cis-trans isomerase; Provisional | 99.96 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.95 | |
| KOG0549 | 188 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.94 | |
| PRK10902 | 269 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.94 | |
| KOG0552 | 226 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.93 | |
| TIGR03516 | 177 | ppisom_GldI peptidyl-prolyl isomerase, gliding mot | 99.93 | |
| PF00254 | 94 | FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer | 99.87 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 99.74 | |
| PRK15095 | 156 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.71 | |
| COG1047 | 174 | SlpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.61 | |
| PRK10737 | 196 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.56 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.27 | |
| TIGR00115 | 408 | tig trigger factor. Trigger factor is a ribosome-a | 99.03 | |
| PRK01490 | 435 | tig trigger factor; Provisional | 98.94 | |
| COG0544 | 441 | Tig FKBP-type peptidyl-prolyl cis-trans isomerase | 98.69 | |
| KOG0549 | 188 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 97.7 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 92.74 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 89.25 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 86.22 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 85.98 |
| >COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.4e-33 Score=220.73 Aligned_cols=128 Identities=29% Similarity=0.452 Sum_probs=117.1
Q ss_pred hhhhhhhccccCCCCCCCCCCCCCCcceEEeCCcEEEEEEecCCCCCCCCCCEEEEEEEEEEcCCCeEEeccccCCccce
Q 028665 20 EIVTEDAAFVRGEPPQDGDGPPKVDSEVEVLHEKVTKQIIKEGHGQKPSKYSTCFLHYRAWAESTRHKFDDTWLEQQPLE 99 (205)
Q Consensus 20 ~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~gi~~~vl~~G~G~~p~~gd~V~v~y~~~~~~~G~~~~st~~~~~p~~ 99 (205)
++..+...|+..+. ....+.++++||+|++++.|.|..|..++.|.+||+|++.| |++|||++.+++|+.
T Consensus 78 ~~~~~~~~f~~~~~---------k~~~v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~~-G~vFDsS~~rg~p~~ 147 (205)
T COG0545 78 ANAAEGKAFLEKNA---------KEKGVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLID-GTVFDSSYDRGQPAE 147 (205)
T ss_pred HhHHhHHHHHhhhc---------ccCCceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecCC-CCccccccccCCCce
Confidence 44455566777766 67788999999999999999999999999999999999998 999999999999999
Q ss_pred eecCCcccccHHHHHHHcCCCCCcEEEEEEeCCCCcCCCCCCCCCCCCCCceEEEEEEEEEee
Q 028665 100 MVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFD 162 (205)
Q Consensus 100 f~lg~~~~~i~gl~~al~~mk~Ge~~~~~ip~~~ayg~~g~~~~~~Ip~~~~lvf~veL~~v~ 162 (205)
|.|| ++|+||.++|.+|++|++|+++|||++|||.+|. ++.||||++|+|+|+|++|.
T Consensus 148 f~l~---~vI~Gw~egl~~M~vG~k~~l~IP~~laYG~~g~--~g~Ippns~LvFeVeLl~v~ 205 (205)
T COG0545 148 FPLG---GVIPGWDEGLQGMKVGGKRKLTIPPELAYGERGV--PGVIPPNSTLVFEVELLDVK 205 (205)
T ss_pred eecC---CeeehHHHHHhhCCCCceEEEEeCchhccCcCCC--CCCCCCCCeEEEEEEEEecC
Confidence 9999 5999999999999999999999999999999997 35599999999999999973
|
|
| >KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated | Back alignment and domain information |
|---|
| >PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00115 tig trigger factor | Back alignment and domain information |
|---|
| >PRK01490 tig trigger factor; Provisional | Back alignment and domain information |
|---|
| >COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 205 | ||||
| 2if4_A | 338 | Crystal Structure Of A Multi-Domain Immunophilin Fr | 1e-88 | ||
| 2f4e_A | 180 | N-Terminal Domain Of Fkbp42 From Arabidopsis Thalia | 5e-76 | ||
| 2dg9_A | 107 | Fk506-Binding Protein Mutant Wl59 Complexed With Ra | 9e-07 | ||
| 2ppo_A | 107 | Crystal Structure Of E60a Mutant Of Fkbp12 Length = | 2e-06 | ||
| 2dg4_A | 107 | Fk506-Binding Protein Mutant Wf59 Complexed With Ra | 3e-06 | ||
| 3b7x_A | 134 | Crystal Structure Of Human Fk506-Binding Protein 6 | 3e-06 | ||
| 1fkk_A | 107 | Atomic Structure Of Fkbp12, An Immunophilin Binding | 4e-06 | ||
| 1rot_A | 149 | Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 | 6e-06 | ||
| 2ppp_A | 107 | Crystal Structure Of E60q Mutant Of Fkbp12 Length = | 8e-06 | ||
| 1bkf_A | 107 | Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX | 9e-06 | ||
| 2fap_A | 107 | The Structure Of The Immunophilin-Immunosuppressant | 1e-05 | ||
| 1fkb_A | 107 | Atomic Structure Of The Rapamycin Human Immunophili | 1e-05 | ||
| 3h9r_B | 109 | Crystal Structure Of The Kinase Domain Of Type I Ac | 1e-05 | ||
| 3uqa_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-05 | ||
| 1q1c_A | 280 | Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt | 2e-05 | ||
| 1tco_C | 107 | Ternary Complex Of A Calcineurin A Fragment, Calcin | 2e-05 | ||
| 1n1a_A | 140 | Crystal Structure Of The N-Terminal Domain Of Human | 3e-05 | ||
| 4drj_A | 144 | O-crystal Structure Of The Ppiase Domain Of Fkbp52, | 3e-05 | ||
| 2vn1_A | 129 | Crystal Structure Of The Fk506-Binding Domain Of Pl | 4e-05 | ||
| 2ofn_A | 135 | Solution Structure Of Fk506-Binding Domain (Fkbd)of | 4e-05 | ||
| 3uf8_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 4e-05 | ||
| 1kt1_A | 457 | Structure Of The Large Fkbp-Like Protein, Fkbp51, I | 5e-05 | ||
| 1kt1_A | 457 | Structure Of The Large Fkbp-Like Protein, Fkbp51, I | 1e-04 | ||
| 1eym_A | 107 | Fk506 Binding Protein Mutant, Homodimeric Complex L | 5e-05 | ||
| 1qz2_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Compl | 5e-05 | ||
| 4ggq_C | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 5e-05 | ||
| 3vaw_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 5e-05 | ||
| 2lgo_A | 130 | Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol | 6e-05 | ||
| 1bl4_A | 107 | Fkbp Mutant F36v Complexed With Remodeled Synthetic | 6e-05 | ||
| 3o5d_A | 264 | Crystal Structure Of A Fragment Of Fkbp51 Comprisin | 7e-05 | ||
| 2ki3_A | 126 | Structural And Biochemical Characterization Of Fk50 | 7e-05 | ||
| 1kt0_A | 457 | Structure Of The Large Fkbp-like Protein, Fkbp51, I | 8e-05 | ||
| 4drh_A | 144 | Co-crystal Structure Of The Ppiase Domain Of Fkbp51 | 1e-04 | ||
| 3o5e_A | 144 | Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 | 1e-04 | ||
| 2ke0_A | 117 | Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso | 1e-04 | ||
| 4dz3_A | 113 | Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is | 1e-04 | ||
| 3o5g_A | 128 | Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 | 1e-04 | ||
| 3o5l_A | 128 | Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le | 2e-04 | ||
| 2y78_A | 133 | Crystal Structure Of Bpss1823, A Mip-Like Chaperone | 2e-04 | ||
| 1r9h_A | 135 | Structural Genomics Of C.Elegans: Fkbp-Type Peptidy | 3e-04 | ||
| 3uqb_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 4e-04 |
| >pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 | Back alignment and structure |
|
| >pdb|2F4E|A Chain A, N-Terminal Domain Of Fkbp42 From Arabidopsis Thaliana Length = 180 | Back alignment and structure |
| >pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 | Back alignment and structure |
| >pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 | Back alignment and structure |
| >pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 | Back alignment and structure |
| >pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 | Back alignment and structure |
| >pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 | Back alignment and structure |
| >pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 | Back alignment and structure |
| >pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 | Back alignment and structure |
| >pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 | Back alignment and structure |
| >pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 | Back alignment and structure |
| >pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 | Back alignment and structure |
| >pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 | Back alignment and structure |
| >pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 | Back alignment and structure |
| >pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 | Back alignment and structure |
| >pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 | Back alignment and structure |
| >pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 | Back alignment and structure |
| >pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 | Back alignment and structure |
| >pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 | Back alignment and structure |
| >pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 | Back alignment and structure |
| >pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 | Back alignment and structure |
| >pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 | Back alignment and structure |
| >pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 | Back alignment and structure |
| >pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 | Back alignment and structure |
| >pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 | Back alignment and structure |
| >pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 | Back alignment and structure |
| >pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 | Back alignment and structure |
| >pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 | Back alignment and structure |
| >pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 | Back alignment and structure |
| >pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 | Back alignment and structure |
| >pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 | Back alignment and structure |
| >pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 | Back alignment and structure |
| >pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 | Back alignment and structure |
| >pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 | Back alignment and structure |
| >pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 205 | |||
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 2e-56 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 2e-50 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 7e-28 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 8e-19 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 9e-19 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 1e-16 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 2e-14 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 3e-14 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 2e-13 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 1e-07 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 5e-14 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 7e-14 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 5e-13 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 2e-12 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 3e-12 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 7e-12 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 1e-10 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 1e-11 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 1e-11 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 3e-11 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 3e-11 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 6e-11 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 1e-10 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 8e-10 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 1e-09 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 4e-09 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 8e-09 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 2e-08 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 2e-08 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 2e-08 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 2e-07 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 7e-07 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 3e-05 |
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
Score = 175 bits (445), Expect = 2e-56
Identities = 135/183 (73%), Positives = 155/183 (84%), Gaps = 3/183 (1%)
Query: 1 MEEVDGEPKSQAPGEVGESEIVTEDAAFVRGEPPQDGDGPPKVDSEVEVLHEKVTKQIIK 60
M+E + Q ESEIVTE +A V EP Q+G+ PPKVDSE EVL EKV+KQIIK
Sbjct: 1 MDE---SLEHQTQTHDQESEIVTEGSAVVHSEPSQEGNVPPKVDSEAEVLDEKVSKQIIK 57
Query: 61 EGHGQKPSKYSTCFLHYRAWAESTRHKFDDTWLEQQPLEMVLGKEKKEMTGLAIGVSSMK 120
EGHG KPSKYSTCFLHYRAW ++++HKF+DTW EQQP+E+VLGKEKKE+ GLAIGV+SMK
Sbjct: 58 EGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMK 117
Query: 121 AGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIG 180
+GE AL+HVGWEL YGKEG+FSFPNV PMADL+YEV +IGFDETKEGKARSDMTVEERIG
Sbjct: 118 SGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIG 177
Query: 181 AAD 183
AAD
Sbjct: 178 AAD 180
|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 205 | |||
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 100.0 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 100.0 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 99.96 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 99.95 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 99.95 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 99.95 | |
| 2lkn_A | 165 | AH receptor-interacting protein; FKBP-type domain, | 99.95 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.95 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 99.95 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.95 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 99.95 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 99.95 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 99.95 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 99.94 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 99.94 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 99.94 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 99.94 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 99.94 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 99.94 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 99.94 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 99.94 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 99.94 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 99.93 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.91 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 99.91 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 99.9 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 99.89 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 99.88 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 99.86 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.86 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 99.75 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 99.73 | |
| 1hxv_A | 113 | Trigger factor; FKBP fold, ppiase, chaperone; NMR | 99.73 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 99.72 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 99.7 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 99.69 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 99.68 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 99.68 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 99.6 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.54 | |
| 1w26_A | 432 | Trigger factor, TF; chaperone, protein folding, ri | 99.46 | |
| 1t11_A | 392 | Trigger factor, TF; helix-turn-helix, four-helix-b | 99.3 | |
| 3gty_X | 433 | Trigger factor, TF; chaperone-client complex, cell | 98.13 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 87.73 |
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-36 Score=239.21 Aligned_cols=179 Identities=75% Similarity=1.185 Sum_probs=121.6
Q ss_pred CCccCCCCCCCCCCCCCcchhhhhhhccccCCCCCCCCCCCCCCcceEEeCCcEEEEEEecCCCCCCCCCCEEEEEEEEE
Q 028665 1 MEEVDGEPKSQAPGEVGESEIVTEDAAFVRGEPPQDGDGPPKVDSEVEVLHEKVTKQIIKEGHGQKPSKYSTCFLHYRAW 80 (205)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~gi~~~vl~~G~G~~p~~gd~V~v~y~~~ 80 (205)
|+|+++. |....++++++..+++++....|..+...||+....+..+++||+|++|++|+|..|..||.|+|||+++
T Consensus 1 ~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~gl~~~vl~~G~G~~~~~Gd~V~v~Y~g~ 77 (180)
T 2f4e_A 1 MDESLEH---QTQTHDQESEIVTEGSAVVHSEPSQEGNVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAW 77 (180)
T ss_dssp ------------------------------------CCSCCCCCSCCEEEETTEEEEEEECCBSCCBCTTCEEEEEEEEE
T ss_pred ChhHhhh---hhccCCccchhhhhhccccccCCCCcccCCcccCCCcEECCCceEEEEEeCCCCCCCCCCCEEEEEEEEE
Confidence 5555544 4466667799999999999999999999999998999999999999999999999999999999999999
Q ss_pred EcCCCeEEeccccCCccceeecCCc-ccccHHHHHHHcCCCCCcEEEEEEeCCCCcCCCCCCCCCCCCCCceEEEEEEEE
Q 028665 81 AESTRHKFDDTWLEQQPLEMVLGKE-KKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLI 159 (205)
Q Consensus 81 ~~~~G~~~~st~~~~~p~~f~lg~~-~~~i~gl~~al~~mk~Ge~~~~~ip~~~ayg~~g~~~~~~Ip~~~~lvf~veL~ 159 (205)
+.++|++|++++..+.|+.|.+|.+ . +|+||+++|.+|++|++++|+|||+++||..+.+.++.||+|++|+|+|+|+
T Consensus 78 l~~dG~~fdss~~~~~p~~f~lG~g~~-vi~G~eeaL~gMk~Ge~~~v~iPp~~aYG~~g~~~~~~Ip~~s~l~F~VeL~ 156 (180)
T 2f4e_A 78 TKNSQHKFEDTWHEQQPIELVLGKEKK-ELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVI 156 (180)
T ss_dssp ETTTCCEEEETTTTTCCEEEETTSCCG-GGHHHHHHHTTCCBTCEEEEEECGGGTTTTTCBSSSSCBCTTCCEEEEEEEE
T ss_pred ECCCCcEEeccCccCCCEEEEeCCCCc-hhHHHHHHHhCCCCCCEEEEEECchHhCCcCCcccCCCcCCCCeEEEEEEEE
Confidence 9866999999988888999999988 6 9999999999999999999999999999999863335799999999999999
Q ss_pred EeeeCCCCCcCCCCCHHHHHHHHH
Q 028665 160 GFDETKEGKARSDMTVEERIGAAD 183 (205)
Q Consensus 160 ~v~~~~~~~~~~~~~~ee~~~~a~ 183 (205)
+|..+.+.+..|.|+.+|++++|.
T Consensus 157 ~v~~~~e~~~~~~mt~eErl~~A~ 180 (180)
T 2f4e_A 157 GFDETKEGKARSDMTVEERIGAAD 180 (180)
T ss_dssp EESCBCCC----------------
T ss_pred EEecCccccccccCCHHHHHhhcC
Confidence 999888766689999999999873
|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* | Back alignment and structure |
|---|
| >2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A | Back alignment and structure |
|---|
| >1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 | Back alignment and structure |
|---|
| >1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A | Back alignment and structure |
|---|
| >3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 205 | ||||
| d1pbka_ | 116 | d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: | 5e-12 | |
| d1u79a_ | 125 | d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha | 2e-11 | |
| d1q1ca2 | 117 | d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H | 7e-11 | |
| d1r9ha_ | 118 | d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd | 8e-11 | |
| d1q6ha_ | 210 | d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 1e-10 | |
| d1kt1a3 | 115 | d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M | 4e-10 | |
| d1yata_ | 113 | d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas | 2e-09 | |
| d1q1ca1 | 120 | d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu | 6e-09 | |
| d2ppna1 | 107 | d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) | 1e-08 | |
| d1kt1a2 | 111 | d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo | 4e-08 | |
| d1fd9a_ | 204 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 2e-07 | |
| d2fbna1 | 153 | a.118.8.1 (A:22-174) Putative 70 kda peptidylproly | 4e-04 | |
| d1p5qa1 | 170 | a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d | 0.001 | |
| d1kt1a1 | 168 | a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M | 0.002 |
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: FKBP25 species: Human (Homo sapiens) [TaxId: 9606]
Score = 58.3 bits (140), Expect = 5e-12
Identities = 29/117 (24%), Positives = 44/117 (37%), Gaps = 9/117 (7%)
Query: 53 KVTKQIIKEGHG-QKPSKYSTCFLHYRAWAE------STRHKFDDTWLEQQPLEMVLGKE 105
K TK ++K+G P K Y + + +PL +
Sbjct: 2 KYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKV-GV 60
Query: 106 KKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFD 162
K + G + +M GE A L + E YGK+G + P A L +EV L+ D
Sbjct: 61 GKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQ-PDAKIPPNAKLTFEVELVDID 116
|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 | Back information, alignment and structure |
|---|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 205 | |||
| d1fd9a_ | 204 | Macrophage infectivity potentiator protein (MIP) { | 99.97 | |
| d1q6ha_ | 210 | Peptidyl-prolyl cis-trans isomerase FkpA {Escheric | 99.97 | |
| d1q1ca1 | 120 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.97 | |
| d1r9ha_ | 118 | FKB-6, N-terminal domain {Caenorhabditis elegans [ | 99.97 | |
| d2ppna1 | 107 | FK-506 binding protein (FKBP12), an immunophilin { | 99.96 | |
| d1yata_ | 113 | Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc | 99.96 | |
| d1kt1a2 | 111 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.96 | |
| d1jvwa_ | 160 | Macrophage infectivity potentiator protein (MIP) { | 99.96 | |
| d1u79a_ | 125 | FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: | 99.95 | |
| d1pbka_ | 116 | FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1kt1a3 | 115 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.93 | |
| d1q1ca2 | 117 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.92 | |
| d1ix5a_ | 151 | Archaeal FKBP {Archaeon Methanococcus thermolithot | 99.68 | |
| d1hxva_ | 85 | Trigger factor PPIase domain {Mycoplasma genitaliu | 99.58 | |
| d1l1pa_ | 106 | Trigger factor PPIase domain {Escherichia coli [Ta | 99.07 | |
| d1t11a3 | 113 | Trigger factor PPIase domain {Vibrio cholerae [Tax | 98.95 |
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: Macrophage infectivity potentiator protein (MIP) species: Legionella pneumophila [TaxId: 446]
Probab=99.97 E-value=3.8e-31 Score=211.49 Aligned_cols=125 Identities=23% Similarity=0.339 Sum_probs=113.9
Q ss_pred hhhccccCCCCCCCCCCCCCCcceEEeCCcEEEEEEecCCCCCCCCCCEEEEEEEEEEcCCCeEEeccccCCccceeecC
Q 028665 24 EDAAFVRGEPPQDGDGPPKVDSEVEVLHEKVTKQIIKEGHGQKPSKYSTCFLHYRAWAESTRHKFDDTWLEQQPLEMVLG 103 (205)
Q Consensus 24 ~~~~~~~~~~~~~~~~~p~~~~~~~~~~~gi~~~vl~~G~G~~p~~gd~V~v~y~~~~~~~G~~~~st~~~~~p~~f~lg 103 (205)
....|+..+. ....+..+++||+|+++++|+|..|..||.|.|||++++.| |++|++++.++.|+.|.+|
T Consensus 79 ~~~~fl~~~~---------~~~~v~~~~sGl~y~v~~~G~G~~p~~~d~v~v~y~g~l~d-g~~f~~s~~~~~p~~~~~~ 148 (204)
T d1fd9a_ 79 KGEAFLTENK---------NKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLID-GTVFDSTEKTGKPATFQVS 148 (204)
T ss_dssp HHHHHHHHHH---------HSTTEEECTTSCEEEEEECCCSCCCCTTCEEEEEEEEEETT-SCEEEEHHHHCSCEEEEGG
T ss_pred HHHHHHHhcc---------cCCceEEecCccEEEEeecCCCcccCCCCEEEEEEEEEECC-CCEecccccCCCCceecCC
Confidence 3455666655 44577889999999999999999999999999999999998 9999999988899999988
Q ss_pred CcccccHHHHHHHcCCCCCcEEEEEEeCCCCcCCCCCCCCCCCCCCceEEEEEEEEEeee
Q 028665 104 KEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDE 163 (205)
Q Consensus 104 ~~~~~i~gl~~al~~mk~Ge~~~~~ip~~~ayg~~g~~~~~~Ip~~~~lvf~veL~~v~~ 163 (205)
++|+||+++|.+|++|++++|+|||++|||..|. ++.||||++|+|+|+|++|.+
T Consensus 149 ---~~i~G~~e~l~~m~~G~~~~~~iP~~laYG~~g~--~~~Ipp~s~l~feveL~~i~k 203 (204)
T d1fd9a_ 149 ---QVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSV--GGPIGPNETLIFKIHLISVKK 203 (204)
T ss_dssp ---GSCHHHHHHHTTCCTTCEEEEEECGGGTTTTCCC--SSSCCTTCCEEEEEEEEEEEC
T ss_pred ---ccchhHHHHhcCCCCCCEEEEEEChHHCcCCCCC--CCCcCcCCcEEEEEEEEEEEc
Confidence 6999999999999999999999999999999998 467999999999999999986
|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|