Citrus Sinensis ID: 028678


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MPFVEQVQYEISSKCRLHPDNDMFRDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDNRHNNLLNVSHGKCLADLCGALHCDFVMNSKSSRSKCNPAAVAKNRHLCESLANRCFPINQGPSASRLHELFLRQFCDAHKCPRKSQPFPKGGRKQPSVFYLSISILTLMLLPIFYLIVYLYQREMRGGTQELKRIPRVGRKAKPS
cccccccccccccccccccccccccHHHHHHcccccccEEEcccccccccHHHHHHHHHcccccccccccccHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHEEccccccccccccccccccccccc
cccEEccEEccccccccccccccccHHHHHHHcccccccEcccccccEccHHHHHHHHHcccccccccccccHHHHHHcHcccHHEEccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcHcccccccc
MPFVEQVQYEISskcrlhpdndmfrdqeqhkihvdinewrcgyckksfraeKFLDqhfdnrhnnllnvshgKCLADLCGAlhcdfvmnskssrskcnpaavAKNRHLCESLanrcfpinqgpsasrLHELFLRQFcdahkcprksqpfpkggrkqpsvFYLSISILTLMLLPIFYLIVYLYQRemrggtqelkriprvgrkakps
MPFVEQVQYEISSKCRLHPDNDMFRDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDNRHNNLLNVSHGKCLADLCGALHCDFVMNSKSSRSKCNPAAVAKNRHLCESLANRCFPINQGPSASRLHELFLRQFCDAHKCPRksqpfpkggrkqpSVFYLSISILTLMLLPIFYLIVYLYQREmrggtqelkriprvgrkakps
MPFVEQVQYEISSKCRLHPDNDMFRDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDNRHNNLLNVSHGKCLADLCGALHCDFVMNSKSSRSKCNPAAVAKNRHLCESLANRCFPINQGPSASRLHELFLRQFCDAHKCPRKSQPFPKGGRKQPSVFYLSISILTLMLLPIFYLIVYLYQREMRGGTQELKRIPRVGRKAKPS
****************************QHKIHVDINEWRCGYCKKSFRAEKFLDQHFDNRHNNLLNVSHGKCLADLCGALHCDFVMN**********AAVAKNRHLCESLANRCFPINQGPSASRLHELFLRQFCDAHKC***************SVFYLSISILTLMLLPIFYLIVYLYQRE*********************
MPFVEQVQYEISSKCRLHPDNDMFRDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDNRHNNLLNVSHGKCLADLCGALHCDFVMN**************KNRHLCESLANRCF************ELFLRQFCDAHKC***************SVFYLSISILTLMLLPIFYLIVYLYQ***********************
********YEISSKCRLHPDNDMFRDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDNRHNNLLNVSHGKCLADLCGALHCDFVMNSK***********AKNRHLCESLANRCFPINQGPSASRLHELFLRQFCDAHKCPRK**********QPSVFYLSISILTLMLLPIFYLIVYLYQREMRGGTQELKRIPRVGRKAKPS
MPFVEQVQYEISSKCRLHPDNDMFRDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDNRHNNLLNVSHGKCLADLCGALHCDFVMNSKSSRSKCNPAAVAKNRHLCESLANRCFPINQGPSASRLHELFLRQFCDAHKCPRKSQPFPKGGRKQPSVFYLSISILTLMLLPIFYLIVYLYQREMR*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFVEQVQYEISSKCRLHPDNDMFRDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDNRHNNLLNVSHGKCLADLCGALHCDFVMNSKSSRSKCNPAAVAKNRHLCESLANRCFPINQGPSASRLHELFLRQFCDAHKCPRKSQPFPKGGRKQPSVFYLSISILTLMLLPIFYLIVYLYQREMRGGTQELKRIPRVGRKAKPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query205
297733623276 unnamed protein product [Vitis vinifera] 1.0 0.742 0.780 7e-95
359491160254 PREDICTED: uncharacterized protein LOC10 1.0 0.807 0.780 2e-94
224133834266 predicted protein [Populus trichocarpa] 0.990 0.763 0.770 6e-94
226531528276 uncharacterized protein LOC100275449 pre 1.0 0.742 0.707 2e-86
449440588280 PREDICTED: uncharacterized protein LOC10 0.995 0.728 0.705 2e-86
238013592275 unknown [Zea mays] gi|413916779|gb|AFW56 1.0 0.745 0.707 2e-86
242083250276 hypothetical protein SORBIDRAFT_08g00828 1.0 0.742 0.707 2e-86
218186624 330 hypothetical protein OsI_37889 [Oryza sa 1.0 0.621 0.712 1e-85
296081316 409 unnamed protein product [Vitis vinifera] 1.0 0.501 0.707 1e-84
115487926275 Os12g0233400 [Oryza sativa Japonica Grou 1.0 0.745 0.702 4e-84
>gi|297733623|emb|CBI14870.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  352 bits (902), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 179/205 (87%)

Query: 1   MPFVEQVQYEISSKCRLHPDNDMFRDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDN 60
           MPFVE+ QY+ISS C+LHPDN +F DQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDN
Sbjct: 72  MPFVEREQYQISSSCKLHPDNHLFSDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDN 131

Query: 61  RHNNLLNVSHGKCLADLCGALHCDFVMNSKSSRSKCNPAAVAKNRHLCESLANRCFPINQ 120
           RH  LLNVSH KCLADLCGALHCD VMNSK+ ++KCNPAA  +NRHLCESLA+ CFP+N 
Sbjct: 132 RHYGLLNVSHSKCLADLCGALHCDLVMNSKTPKAKCNPAAAVRNRHLCESLADSCFPVNH 191

Query: 121 GPSASRLHELFLRQFCDAHKCPRKSQPFPKGGRKQPSVFYLSISILTLMLLPIFYLIVYL 180
           G SASRLH++FLRQFCDAH C    +PF +GG KQPS+FYL+ISILTLM+LP+FY+IVYL
Sbjct: 192 GLSASRLHDIFLRQFCDAHTCSGGGKPFSRGGMKQPSIFYLAISILTLMMLPVFYVIVYL 251

Query: 181 YQREMRGGTQELKRIPRVGRKAKPS 205
           YQREMR GTQELKRI R G K KPS
Sbjct: 252 YQREMRNGTQELKRISRHGLKTKPS 276




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359491160|ref|XP_002262859.2| PREDICTED: uncharacterized protein LOC100244377 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224133834|ref|XP_002321672.1| predicted protein [Populus trichocarpa] gi|222868668|gb|EEF05799.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|226531528|ref|NP_001142988.1| uncharacterized protein LOC100275449 precursor [Zea mays] gi|195612594|gb|ACG28127.1| zinc finger protein [Zea mays] Back     alignment and taxonomy information
>gi|449440588|ref|XP_004138066.1| PREDICTED: uncharacterized protein LOC101218367 [Cucumis sativus] Back     alignment and taxonomy information
>gi|238013592|gb|ACR37831.1| unknown [Zea mays] gi|413916779|gb|AFW56711.1| zinc finger protein [Zea mays] Back     alignment and taxonomy information
>gi|242083250|ref|XP_002442050.1| hypothetical protein SORBIDRAFT_08g008280 [Sorghum bicolor] gi|241942743|gb|EES15888.1| hypothetical protein SORBIDRAFT_08g008280 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|218186624|gb|EEC69051.1| hypothetical protein OsI_37889 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|296081316|emb|CBI17698.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|115487926|ref|NP_001066450.1| Os12g0233400 [Oryza sativa Japonica Group] gi|108862374|gb|ABA96879.2| zinc finger family protein, putative, expressed [Oryza sativa Japonica Group] gi|108862375|gb|ABG21933.1| zinc finger family protein, putative, expressed [Oryza sativa Japonica Group] gi|108862376|gb|ABG21934.1| zinc finger family protein, putative, expressed [Oryza sativa Japonica Group] gi|108862377|gb|ABG21935.1| zinc finger family protein, putative, expressed [Oryza sativa Japonica Group] gi|113648957|dbj|BAF29469.1| Os12g0233400 [Oryza sativa Japonica Group] gi|215697514|dbj|BAG91508.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query205
TAIR|locus:2162012271 AT5G63280 "AT5G63280" [Arabido 0.995 0.752 0.710 1.2e-83
TAIR|locus:2168783272 AT5G40710 "AT5G40710" [Arabido 0.990 0.746 0.588 1e-68
FB|FBgn0031257 667 CG4133 [Drosophila melanogaste 0.458 0.140 0.347 2.6e-16
CGD|CAL0005892132 orf19.4195 [Candida albicans ( 0.326 0.507 0.373 3.1e-07
UNIPROTKB|Q59NH5132 CaO19.4195 "Potential zinc fin 0.326 0.507 0.373 3.1e-07
TAIR|locus:2162012 AT5G63280 "AT5G63280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 838 (300.0 bits), Expect = 1.2e-83, P = 1.2e-83
 Identities = 145/204 (71%), Positives = 173/204 (84%)

Query:     2 PFVEQVQYEISSKCRLHPDNDMFRDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDNR 61
             PFVE+ +YEI   CRLHPDND++RDQE HK+HVD+ EW+CGYCKKSF  EKFLD+HF  R
Sbjct:    68 PFVERERYEIPKNCRLHPDNDLYRDQEHHKVHVDVFEWKCGYCKKSFNDEKFLDKHFSTR 127

Query:    62 HNNLLNVSHGKCLADLCGALHCDFVMNSKSSRSKCNPAAVAKNRHLCESLANRCFPINQG 121
             H NLLN +  KCLADLCGALHCDFV++SK  +SKCNP AVAKNRHLCES+AN CFP++QG
Sbjct:   128 HYNLLNTTDTKCLADLCGALHCDFVLSSKKPKSKCNPPAVAKNRHLCESVANSCFPVSQG 187

Query:   122 PSASRLHELFLRQFCDAHKCPRKSQPFPKGGRKQPSVFYLSISILTLMLLPIFYLIVYLY 181
             PSASRLHE FLRQFCDAH C    +PFP+GG+K+  VFYL+ISILTLMLLP+FYL+V+L+
Sbjct:   188 PSASRLHEHFLRQFCDAHTCTGNDKPFPRGGKKKSGVFYLAISILTLMLLPLFYLLVFLH 247

Query:   182 QREMRGGTQELKRIPRVGRKAKPS 205
             QRE R GTQ+L+RI + G+K KPS
Sbjct:   248 QREKRSGTQDLRRIIKSGKKTKPS 271




GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2168783 AT5G40710 "AT5G40710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0031257 CG4133 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
CGD|CAL0005892 orf19.4195 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59NH5 CaO19.4195 "Potential zinc finger protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 205
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 98.4
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.0
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.99
PF04959214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 95.75
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.19
smart0035526 ZnF_C2H2 zinc finger. 95.15
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 94.94
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.96
PHA00733128 hypothetical protein 93.56
PHA0061644 hypothetical protein 93.16
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 90.84
PHA0276855 hypothetical protein; Provisional 90.75
PF12273130 RCR: Chitin synthesis regulation, resistance to Co 89.05
PF1501838 InaF-motif: TRP-interacting helix 85.88
PHA0073279 hypothetical protein 85.0
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 84.21
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 83.97
PHA0073279 hypothetical protein 81.47
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 81.39
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
Probab=98.40  E-value=3e-08  Score=86.73  Aligned_cols=67  Identities=24%  Similarity=0.601  Sum_probs=59.4

Q ss_pred             CCCCCCCCccCCchHhhhhhh-cCcccccccccccCCchhhHhhhhhhcccccccCC--cc----Cchhhhccc
Q 028678           14 KCRLHPDNDMFRDQEQHKIHV-DINEWRCGYCKKSFRAEKFLDQHFDNRHNNLLNVS--HG----KCLADLCGA   80 (205)
Q Consensus        14 ~C~L~P~~D~F~~~E~~k~h~-~~h~~rC~~C~K~F~sE~~LDlHidnrH~~ll~~~--~~----~CLad~C~~   80 (205)
                      .|+.--.-.+|..-+.||.|| ..|.+-|.+|+|.|||.+.||.||-|-|+++.++.  |+    .||+|+|..
T Consensus        81 ~cqvagc~~~~d~lD~~E~hY~~~h~~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~  154 (253)
T KOG4173|consen   81 ACQVAGCCQVFDALDDYEHHYHTLHGNSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTE  154 (253)
T ss_pred             cccccchHHHHhhhhhHHHhhhhcccchhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhh
Confidence            577666667899999999999 88999999999999999999999999999988754  43    899999974



>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls Back     alignment and domain information
>PF15018 InaF-motif: TRP-interacting helix Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query205
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 97.1
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 97.07
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 96.96
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 96.9
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 96.79
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 96.63
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 96.59
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 96.49
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 96.48
2lv2_A85 Insulinoma-associated protein 1; structural genomi 96.44
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 96.44
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 96.4
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 96.39
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 96.35
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 96.34
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 96.33
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 96.32
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 96.31
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 96.28
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 96.15
1paa_A30 Yeast transcription factor ADR1; transcription reg 96.09
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 96.07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 96.02
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 96.01
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 95.99
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 95.99
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 95.94
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 95.91
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 95.88
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 95.88
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 95.86
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 95.84
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 95.83
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 95.74
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 95.72
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.67
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 95.67
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 95.66
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 95.64
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 95.62
1ard_A29 Yeast transcription factor ADR1; transcription reg 95.61
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 95.54
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 95.53
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 95.5
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.5
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 95.47
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 95.45
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 95.4
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 95.38
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 95.36
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.35
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 95.34
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 95.31
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 95.27
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 95.25
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 95.24
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 95.22
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 95.18
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 94.17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 95.15
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 95.14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 95.14
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 95.12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 95.12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 95.1
1tf6_A190 Protein (transcription factor IIIA); complex (tran 95.1
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 95.05
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 95.01
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.01
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 94.98
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 94.97
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 94.97
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 94.96
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 94.96
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 94.96
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.94
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.94
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.93
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 94.92
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.91
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 94.91
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.91
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 94.88
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 94.87
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 93.87
1tf6_A190 Protein (transcription factor IIIA); complex (tran 94.85
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.84
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 94.83
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 94.83
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.81
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 93.77
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 94.75
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.74
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 94.74
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 94.73
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.72
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 94.71
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.71
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.7
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 94.7
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.67
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.66
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.66
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 94.66
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.65
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.64
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.64
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.63
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 94.62
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.59
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.59
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.59
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 94.58
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.58
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.56
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.56
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.56
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 94.55
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 94.55
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.53
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 94.52
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 94.52
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.52
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 94.51
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.51
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 94.51
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 94.5
2epa_A72 Krueppel-like factor 10; transforming growth facto 94.5
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.5
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.5
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.5
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.47
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.46
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 94.42
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.37
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 94.37
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.36
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 94.35
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.34
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 94.34
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 94.33
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.33
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.33
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 94.32
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.32
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 94.24
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.24
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 94.23
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 94.22
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 94.21
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.21
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.2
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 94.18
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.18
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.18
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.13
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.12
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 94.1
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 94.09
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 94.07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 94.06
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 94.05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 94.03
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.02
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 93.98
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 93.97
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.95
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 93.94
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.92
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 93.9
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 93.83
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 93.81
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.71
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 93.71
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 93.69
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.68
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.64
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 93.63
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 93.62
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.61
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 93.58
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.58
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 93.5
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 93.46
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 93.4
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 93.34
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 93.29
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 93.26
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 93.24
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 93.09
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 93.04
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 93.02
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 92.99
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 92.98
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 92.84
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 92.59
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 92.19
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 92.17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 91.86
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 91.72
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 91.61
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 91.2
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 91.19
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 91.08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 91.02
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 90.86
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 90.39
2lv2_A85 Insulinoma-associated protein 1; structural genomi 90.05
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 89.88
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 89.79
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.87
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 88.62
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 88.2
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.19
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 88.02
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 87.66
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 85.48
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 85.15
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 85.1
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 84.81
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 84.28
3ax1_A358 Serrate RNA effector molecule; miRNA processing, p 84.1
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 83.36
2epa_A72 Krueppel-like factor 10; transforming growth facto 81.83
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 81.11
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 80.72
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 80.36
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 80.11
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 80.08
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
Probab=97.10  E-value=0.00046  Score=44.19  Aligned_cols=51  Identities=25%  Similarity=0.516  Sum_probs=41.2

Q ss_pred             CCCCCCCCCccCCchHhhhhhhcCc----ccccccccccCCchhhHhhhhhhccccc
Q 028678           13 SKCRLHPDNDMFRDQEQHKIHVDIN----EWRCGYCKKSFRAEKFLDQHFDNRHNNL   65 (205)
Q Consensus        13 ~~C~L~P~~D~F~~~E~~k~h~~~h----~~rC~~C~K~F~sE~~LDlHidnrH~~l   65 (205)
                      ..|+.-  ...|.....++.|...|    .++|..|+|.|.+...|..|+...|..-
T Consensus         3 ~~C~~C--~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~   57 (60)
T 2adr_A            3 FVCEVC--TRAFARQEHLKRHYRSHTNEKPYPCGLCNRAFTRRDLLIRHAQKIHSGN   57 (60)
T ss_dssp             BCCTTT--CCCBSCHHHHHHHHHTTTSSCSEECTTTCCEESSHHHHHHHHTTTSCCS
T ss_pred             CcCCCC--ccccCCHHHHHHHHHHhCCCCCccCCCCCCccCCHHHHHHHHHHHcCCc
Confidence            346543  35799999999998555    3789999999999999999998888653



>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3ax1_A Serrate RNA effector molecule; miRNA processing, protein binding; 2.74A {Arabidopsis thaliana} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query205
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.62
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.33
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 95.04
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 94.84
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 94.8
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 94.69
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.66
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 94.4
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 93.86
d2cota238 Zinc finger and SCAN domain-containing protein 16, 93.68
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 93.17
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 91.84
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.7
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.23
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.42
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 90.04
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 89.34
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.33
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.05
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 87.48
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 87.08
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 86.8
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 86.75
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 86.26
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 86.15
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 85.38
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 85.31
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 82.16
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=95.62  E-value=0.0016  Score=41.46  Aligned_cols=40  Identities=25%  Similarity=0.581  Sum_probs=32.5

Q ss_pred             CCccCCchHhhhhhhcC----cccccccccccCCchhhHhhhhh
Q 028678           20 DNDMFRDQEQHKIHVDI----NEWRCGYCKKSFRAEKFLDQHFD   59 (205)
Q Consensus        20 ~~D~F~~~E~~k~h~~~----h~~rC~~C~K~F~sE~~LDlHid   59 (205)
                      ..-.|.....+..|..+    -.++|.+|||.|.+...|..|+.
T Consensus         8 Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r   51 (53)
T d2csha1           8 CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK   51 (53)
T ss_dssp             TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHT
T ss_pred             CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHh
Confidence            34578888888888744    34899999999999999999973



>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure