Citrus Sinensis ID: 028709

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----

MFWILYGLPVVHPDSTLVITINAVGLALELIYLSIFCFTNICFYFARRTCHLITCLILAYLQTVVGLGLLAEVIFVGVIAIITFLAFHTHTSRSMFVGILCDIFNIIMYASPLTIWHKVITTKSVEYMPFFLSLANFANGCIWTAYALIKLDIYILVSNGLGAILGFIQLVIYACYYKSTPKKGNDDDFVKPKPTEVQHSGAAMA

cEEEEccccccccccEEEEEEHHHHHHHHHHHHHHHHHccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHHHcccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccHHccHHHHHHHHHHHHHHEEEEEEcccccccccccccccccccccccccccc

xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Bidirectional sugar transporter SWEET4	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	probable	Q944M5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted