Citrus Sinensis ID: 028732


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MGSVTCNPLAPPSTHLLLNPSKIPKFCHSRRQLHGSQRASKIIAYYGLKTPPYKLDALEPYMSKRTLEVHWGELHRGYVEGLNKHLAKDDVLYGYTLDELVKVSYNSGNPLPVFNNAVQVWNHDFFWESMQPGGGDIPKYGVLEQIEKDFGSFTNFKEKFIGAALTLFGSGYVWLVLKREERRLAVVKTSNAINPLVWNDIVRS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccEEcHHHHHHHHHHHccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEEEEcccccEEEEccccccccccccccccc
**********************IPKFCH********QRASKIIAYYGLKTPPYKLDALEPYMSKRTLEVHWGELHRGYVEGLNKHLAKDDVLYGYTLDELVKVSYNSGNPLPVFNNAVQVWNHDFFWESMQPGGGDIPKYGVLEQIEKDFGSFTNFKEKFIGAALTLFGSGYVWLVLKREERRLAVVKTSNAINPLVWN*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSVTCNPLAPPSTHLLLNPSKIPKFCHSRRQLHGSQRASKIIAYYGLKTPPYKLDALEPYMSKRTLEVHWGELHRGYVEGLNKHLAKDDVLYGYTLDELVKVSYNSGNPLPVFNNAVQVWNHDFFWESMQPGGGDIPKYGVLEQIEKDFGSFTNFKEKFIGAALTLFGSGYVWLVLKREERRLAVVKTSNAINPLVWNDIVRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Superoxide dismutase [Fe] 3, chloroplastic Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems (By similarity). Plays important role in chloroplast development, particularly in the maintenance of thylakoids membranes. Seems to act as a heterodimer with FSD2.probableQ9FMX0
Superoxide dismutase [Fe] 2, chloroplastic Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.probableQ5VSB7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.15.-.-Acting on superoxide as acceptor.probable
1.15.1.-Acting on superoxide as acceptor.probable
1.15.1.1Superoxide dismutase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UNF, chain X
Confidence level:very confident
Coverage over the Query: 41-200
View the alignment between query and template
View the model in PyMOL
Template: 2CW3, chain A
Confidence level:very confident
Coverage over the Query: 43-199
View the alignment between query and template
View the model in PyMOL