Citrus Sinensis ID: 028736

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MTLRLMKNSNWVSFLFIVFAFFLYFYKYPSSFSAKNMATQEAPKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQDFEVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGSC
ccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEcccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHccccccccccEEcccccccHHHHHHHcccccccccccccccEEcEEcccccEEEECcccccHHHHHHHHHHHHccc
*******NSNWVSFLFIVFAFFLYFYKYPS*************KSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQDFEVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGS*
xxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLRLMKNSNWVSFLFIVFAFFLYFYKYPSSFSAKNMATQEAPKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQDFEVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGSC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable glutathione peroxidase 2 May constitute a glutathione peroxidase-like protective system against oxidative stresses.confidentO04922
Probable phospholipid hydroperoxide glutathione peroxidase Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.probableQ9FXS3
Probable phospholipid hydroperoxide glutathione peroxidase Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.probableQ9LEF0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P5Q, chain A
Confidence level:very confident
Coverage over the Query: 44-203
View the alignment between query and template
View the model in PyMOL