Citrus Sinensis ID: 028736

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----

MTLRLMKNSNWVSFLFIVFAFFLYFYKYPSSFSAKNMATQEAPKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQDFEVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGSC

ccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEcccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHccccccccccEEcccccccHHHHHHHcccccccccccccccEEcEEcccccEEEEEcccccHHHHHHHHHHHHccc

cccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEccccccEEHHHHcccEEEEEEEccccccHHHHHHHHHHHHHHHHHHcEEEEEEEcccccccccccHHHHHHHHHHccccEcccccEEEccccccHHHHHHHHHcccccccccEEEccEEEEEcccccEEEEccccccHHHHHHHHHHHHHcc

mtlrlmknsnwVSFLFIVFAFFLYFykypssfsaknmatqeapksiydftvkdirgndvslsgyrgKVLLVVNVASkcgltqsnYKELNVLYEKYknqdfevlafpcnqfagqepgsneeIQEVACTMFkaefpifdkidvngknaaPIYKFLksekggflgdAIKWNFTKFLvnkegkvveryapttsplKIEKDIQNLLGSC

mtlrlmknsnWVSFLFIVFAFFLYFYKYPSSFSAKNMATQEAPKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASkcgltqsnYKELNVLYEKYKNQDFEVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFlvnkegkvveryapttsplkiekdiqnllgsc

MTLRLMKNSNWVSflfivfafflyfyKYPSSFSAKNMATQEAPKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQDFEVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGSC

*******NSNWVSFLFIVFAFFLYFYKYPSSFSAKNM****APKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQDFEVLAFPCNQFAGQ*****EEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVNKEGKVVERYAP******************

*********NW*SFLFIVFAFFLYFYKY*****************IYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQDFEVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGS*

*TL*LMKNSNWVSFLFIVFAFFLYFYKYPS*************KSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQDFEVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGSC

iiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		204	2.2.26 [Sep-21-2011]
O04922		169	Probable glutathione pero	yes	no	0.803	0.970	0.768	9e-72
O22850		206	Probable glutathione pero	no	no	0.955	0.946	0.617	9e-71
Q9SZ54		233	Putative glutathione pero	no	no	0.813	0.712	0.746	4e-70
O48646		232	Probable phospholipid hyd	no	no	0.843	0.741	0.709	6e-70
Q9LEF0		170	Probable phospholipid hyd	N/A	no	0.818	0.982	0.715	6e-69
Q06652		167	Probable phospholipid hyd	no	no	0.803	0.982	0.733	2e-68
P30708		169	Probable phospholipid hyd	N/A	no	0.813	0.982	0.712	2e-68
Q9FXS3		169	Probable phospholipid hyd	N/A	no	0.813	0.982	0.706	3e-68
O24031		169	Probable phospholipid hyd	N/A	no	0.813	0.982	0.688	2e-67
O49069		170	Probable phospholipid hyd	N/A	no	0.813	0.976	0.708	4e-67

>sp\|O04922\|GPX2_ARATH Probable glutathione peroxidase 2 OS=Arabidopsis thaliana GN=GPX2 PE=1 SV=1	Back alignment and function desciption

 Score =  269 bits (688), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 126/164 (76%), Positives = 142/164 (86%)

Query: 41  EAPKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQDF 100
           E+PKSIYDFTVKDI GNDVSL  Y+GK LLVVNVASKCGLT +NYKELNVLYEKYK Q  
Sbjct: 4   ESPKSIYDFTVKDIGGNDVSLDQYKGKTLLVVNVASKCGLTDANYKELNVLYEKYKEQGL 63

Query: 101 EVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGF 160
           E+LAFPCNQF GQEPG+NEEIQ+  CT FKAEFPIFDK+DVNGKN AP+YK+LK+EKGG 
Sbjct: 64  EILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEKGGL 123

Query: 161 LGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGSC 204
           L DAIKWNFTKFLV+ +GKV++RY+P TSPL+ EKDIQ  LG  
Sbjct: 124 LIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDIQTALGQA 167

May constitute a glutathione peroxidase-like protective system against oxidative stresses.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 9

>sp\|O22850\|GPX3_ARATH Probable glutathione peroxidase 3, mitochondrial OS=Arabidopsis thaliana GN=GPX3 PE=1 SV=1	Back alignment and function description

>sp\|Q9SZ54\|GPX7_ARATH Putative glutathione peroxidase 7, chloroplastic OS=Arabidopsis thaliana GN=GPX7 PE=3 SV=2	Back alignment and function description

>sp\|O48646\|GPX6_ARATH Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial OS=Arabidopsis thaliana GN=GPX6 PE=2 SV=2	Back alignment and function description

>sp\|Q9LEF0\|GPX4_MESCR Probable phospholipid hydroperoxide glutathione peroxidase OS=Mesembryanthemum crystallinum GN=GPXMC1 PE=2 SV=1	Back alignment and function description

>sp\|Q06652\|GPX4_CITSI Probable phospholipid hydroperoxide glutathione peroxidase OS=Citrus sinensis GN=CSA PE=1 SV=1	Back alignment and function description

>sp\|P30708\|GPX4_NICSY Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana sylvestris PE=2 SV=1	Back alignment and function description

>sp\|Q9FXS3\|GPX4_TOBAC Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|O24031\|GPX4_SOLLC Probable phospholipid hydroperoxide glutathione peroxidase OS=Solanum lycopersicum GN=GPXle-1 PE=2 SV=1	Back alignment and function description

>sp\|O49069\|GPX4_GOSHI Probable phospholipid hydroperoxide glutathione peroxidase OS=Gossypium hirsutum PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		204
255577761		167	glutathione peroxidase, putative [Ricinu	0.808	0.988	0.896	2e-82
224095706		167	glutathione peroxidase [Populus trichoca	0.803	0.982	0.890	1e-81
334145759		167	putative glutathione peroxidase [Jatroph	0.808	0.988	0.860	8e-80
351722129		199	uncharacterized protein LOC100527297 [Gl	0.941	0.964	0.757	2e-78
225433843		167	PREDICTED: probable glutathione peroxida	0.813	0.994	0.843	1e-77
357521361		198	Glutathione peroxidase [Medicago truncat	0.965	0.994	0.709	2e-77
17646156		167	phospholipid hydroperoxide glutathione p	0.808	0.988	0.824	7e-75
388512907		207	unknown [Lotus japonicus]	0.985	0.971	0.660	1e-74
351720940		166	uncharacterized protein LOC100306590 [Gl	0.808	0.993	0.812	3e-74
253761866		205	hypothetical protein SORBIDRAFT_0010s007	0.803	0.8	0.792	7e-74

>gi\|255577761\|ref\|XP_002529755.1\| glutathione peroxidase, putative [Ricinus communis] gi\|223530753\|gb\|EEF32621.1\| glutathione peroxidase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 148/165 (89%), Positives = 158/165 (95%)

Query: 39  TQEAPKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQ 98
            +E+ KSIYDFTVKDIRGNDVSL+ Y GKVLL+VNVASKCGLTQSNYKELNVLYEKYKNQ
Sbjct: 2   AEESSKSIYDFTVKDIRGNDVSLNEYSGKVLLIVNVASKCGLTQSNYKELNVLYEKYKNQ 61

Query: 99  DFEVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKG 158
            FE+LAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKI+VNGKN AP+YK+LKSEKG
Sbjct: 62  GFEILAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIEVNGKNTAPLYKYLKSEKG 121

Query: 159 GFLGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGS 203
           G+ GDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLG+
Sbjct: 122 GYFGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGA 166

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224095706\|ref\|XP_002310444.1\| glutathione peroxidase [Populus trichocarpa] gi\|222853347\|gb\|EEE90894.1\| glutathione peroxidase [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|334145759\|gb\|AEG64804.1\| putative glutathione peroxidase [Jatropha curcas]	Back alignment and taxonomy information

>gi\|351722129\|ref\|NP_001237745.1\| uncharacterized protein LOC100527297 [Glycine max] gi\|255632031\|gb\|ACU16368.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|225433843\|ref\|XP_002263327.1\| PREDICTED: probable glutathione peroxidase 2 [Vitis vinifera] gi\|147841713\|emb\|CAN60579.1\| hypothetical protein VITISV_034775 [Vitis vinifera] gi\|297743759\|emb\|CBI36642.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357521361\|ref\|XP_003630969.1\| Glutathione peroxidase [Medicago truncatula] gi\|355524991\|gb\|AET05445.1\| Glutathione peroxidase [Medicago truncatula] gi\|388521469\|gb\|AFK48796.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|17646156\|gb\|AAL40914.1\| phospholipid hydroperoxide glutathione peroxidase [Momordica charantia]	Back alignment and taxonomy information

>gi\|388512907\|gb\|AFK44515.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|351720940\|ref\|NP_001237193.1\| uncharacterized protein LOC100306590 [Glycine max] gi\|255628997\|gb\|ACU14843.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|253761866\|ref\|XP_002489307.1\| hypothetical protein SORBIDRAFT_0010s007790 [Sorghum bicolor] gi\|241946955\|gb\|EES20100.1\| hypothetical protein SORBIDRAFT_0010s007790 [Sorghum bicolor]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		204
TAIR\|locus:2065928		169	GPX2 "glutathione peroxidase 2	0.794	0.958	0.777	1.2e-67
TAIR\|locus:2116782		233	GPX7 "glutathione peroxidase 7	0.813	0.712	0.746	3.2e-65
TAIR\|locus:2139712		232	GPX6 "glutathione peroxidase 6	0.843	0.741	0.709	5.2e-65
TAIR\|locus:2058233		206	GPX3 "glutathione peroxidase 3	0.848	0.839	0.677	5.4e-63
TAIR\|locus:2040179		236	GPX1 "glutathione peroxidase 1	0.813	0.703	0.698	1.3e-61
TAIR\|locus:2031331		167	GPX8 "AT1G63460" [Arabidopsis	0.803	0.982	0.612	1.4e-55
TAIR\|locus:2099252		173	GPX5 "glutathione peroxidase 5	0.774	0.913	0.664	2.9e-55
TAIR\|locus:2039346		170	GPX4 "glutathione peroxidase 4	0.803	0.964	0.612	2.4e-53
WB\|WBGene00009165		163	gpx-1 [Caenorhabditis elegans	0.774	0.969	0.594	2.5e-49
WB\|WBGene00011045		163	gpx-2 [Caenorhabditis elegans	0.769	0.963	0.573	4.8e-46

TAIR\|locus:2065928 GPX2 "glutathione peroxidase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 687 (246.9 bits), Expect = 1.2e-67, P = 1.2e-67
 Identities = 126/162 (77%), Positives = 142/162 (87%)

Query:    41 EAPKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQDF 100
             E+PKSIYDFTVKDI GNDVSL  Y+GK LLVVNVASKCGLT +NYKELNVLYEKYK Q  
Sbjct:     4 ESPKSIYDFTVKDIGGNDVSLDQYKGKTLLVVNVASKCGLTDANYKELNVLYEKYKEQGL 63

Query:   101 EVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGF 160
             E+LAFPCNQF GQEPG+NEEIQ+  CT FKAEFPIFDK+DVNGKN AP+YK+LK+EKGG 
Sbjct:    64 EILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEKGGL 123

Query:   161 LGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLG 202
             L DAIKWNFTKFLV+ +GKV++RY+P TSPL+ EKDIQ  LG
Sbjct:   124 LIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDIQTALG 165

GO:0004602 "glutathione peroxidase activity" evidence=IEA;ISS

GO:0005739 "mitochondrion" evidence=ISM

GO:0006979 "response to oxidative stress" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0005829 "cytosol" evidence=NAS

GO:0009407 "toxin catabolic process" evidence=RCA

GO:0005886 "plasma membrane" evidence=IDA

TAIR\|locus:2116782 GPX7 "glutathione peroxidase 7" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2139712 GPX6 "glutathione peroxidase 6" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2058233 GPX3 "glutathione peroxidase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2040179 GPX1 "glutathione peroxidase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031331 GPX8 "AT1G63460" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2099252 GPX5 "glutathione peroxidase 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2039346 GPX4 "glutathione peroxidase 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

WB\|WBGene00009165 gpx-1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

WB\|WBGene00011045 gpx-2 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9Z9N7	BSAA_BACHD	1, ., -, ., -, ., -	0.5286	0.7647	0.9936	yes	no
P38143	GPX2_YEAST	1, ., 1, 1, ., 1, ., 9	0.5189	0.7647	0.9629	yes	no
O23814	GPX4_SPIOL	1, ., 1, 1, ., 1, ., 1, 2	0.7187	0.7843	0.9356	N/A	no
O70325	GPX41_MOUSE	1, ., 1, 1, ., 1, ., 1, 2	0.5064	0.75	0.7766	yes	no
Q9N2J2	GPX4_BOVIN	1, ., 1, 1, ., 1, ., 1, 2	0.5192	0.75	0.7766	yes	no
A1KV41	GPXA_NEIMF	No assigned EC number	0.5168	0.7598	0.8757	yes	no
P0A0T5	GPXA_NEIMB	No assigned EC number	0.5168	0.7598	0.8757	yes	no
P0A0T4	GPXA_NEIMA	No assigned EC number	0.5168	0.7598	0.8757	yes	no
Q9CFV1	GPO_LACLA	1, ., 1, 1, ., 1, ., 9	0.5159	0.7647	0.9936	yes	no
Q9FXS3	GPX4_TOBAC	1, ., 1, 1, ., 1, ., 1, 2	0.7065	0.8137	0.9822	N/A	no
Q9LEF0	GPX4_MESCR	1, ., 1, 1, ., 1, ., 1, 2	0.7159	0.8186	0.9823	N/A	no
Q06652	GPX4_CITSI	1, ., 1, 1, ., 1, ., 1, 2	0.7333	0.8039	0.9820	no	no
O04922	GPX2_ARATH	1, ., 1, 1, ., 1, ., 9	0.7682	0.8039	0.9704	yes	no
O23968	GPX4_HELAN	1, ., 1, 1, ., 1, ., 1, 2	0.7450	0.75	0.85	N/A	no
O32770	GPO_LACLM	1, ., 1, 1, ., 1, ., 9	0.5161	0.7549	0.9808	yes	no
O24031	GPX4_SOLLC	1, ., 1, 1, ., 1, ., 1, 2	0.6886	0.8137	0.9822	N/A	no
P52035	BSAA_BACSU	1, ., -, ., -, ., -	0.5063	0.7647	0.975	yes	no
P36968	GPX4_PIG	1, ., 1, 1, ., 1, ., 1, 2	0.5064	0.75	0.7766	yes	no
P36969	GPX4_HUMAN	1, ., 1, 1, ., 1, ., 1, 2	0.5189	0.7598	0.7868	yes	no
P30708	GPX4_NICSY	1, ., 1, 1, ., 1, ., 1, 2	0.7125	0.8137	0.9822	N/A	no
P36970	GPX41_RAT	1, ., 1, 1, ., 1, ., 1, 2	0.5064	0.75	0.7766	yes	no
O02621	GPX1_CAEEL	1, ., 1, 1, ., 1, ., 9	0.5949	0.7745	0.9693	yes	no
O59858	GPX1_SCHPO	1, ., 1, 1, ., 1, ., 9	0.5096	0.7549	0.9746	yes	no
O49069	GPX4_GOSHI	1, ., 1, 1, ., 1, ., 1, 2	0.7083	0.8137	0.9764	N/A	no
Q32QL6	GPX4_CALJA	1, ., 1, 1, ., 1, ., 1, 2	0.5220	0.7647	0.7918	yes	no
O23970	GPX1_HELAN	1, ., 1, 1, ., 1, ., 9	0.6686	0.8088	0.9880	N/A	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.11.1	LOW CONFIDENCE prediction!
4th Layer	1.11.1.12	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		204
PLN02412		167	PLN02412, PLN02412, probable glutathione peroxidas	1e-111
PLN02399		236	PLN02399, PLN02399, phospholipid hydroperoxide glu	2e-94
cd00340		152	cd00340, GSH_Peroxidase, Glutathione (GSH) peroxid	4e-92
COG0386		162	COG0386, BtuE, Glutathione peroxidase [Posttransla	3e-83
PTZ00256		183	PTZ00256, PTZ00256, glutathione peroxidase; Provis	2e-57
PRK10606		183	PRK10606, btuE, putative glutathione peroxidase; P	7e-56
pfam00255		108	pfam00255, GSHPx, Glutathione peroxidase	4e-54
PTZ00056		199	PTZ00056, PTZ00056, glutathione peroxidase; Provis	8e-50
TIGR02540		153	TIGR02540, gpx7, putative glutathione peroxidase G	2e-47
cd02966		116	cd02966, TlpA_like_family, TlpA-like family; compo	9e-08
pfam00578		124	pfam00578, AhpC-TSA, AhpC/TSA family	8e-06
cd02969		171	cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 fam	6e-04
pfam08534		142	pfam08534, Redoxin, Redoxin	0.001

>gnl\|CDD\|166053 PLN02412, PLN02412, probable glutathione peroxidase	Back alignment and domain information

 Score =  315 bits (808), Expect = e-111
 Identities = 138/164 (84%), Positives = 151/164 (92%)

Query: 40  QEAPKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQD 99
           +E+PKSIYDFTVKDI GNDVSL+ Y+GKVLL+VNVASKCGLT SNYKELNVLYEKYK Q 
Sbjct: 3   EESPKSIYDFTVKDIGGNDVSLNQYKGKVLLIVNVASKCGLTDSNYKELNVLYEKYKEQG 62

Query: 100 FEVLAFPCNQFAGQEPGSNEEIQEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGG 159
           FE+LAFPCNQF GQEPGSNEEIQ+  CT FKAEFPIFDK+DVNGKN AP+YK+LK+EKGG
Sbjct: 63  FEILAFPCNQFLGQEPGSNEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEKGG 122

Query: 160 FLGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGS 203
             GDAIKWNFTKFLV+KEGKVV+RYAPTTSPLKIEKDIQNLLG 
Sbjct: 123 LFGDAIKWNFTKFLVSKEGKVVQRYAPTTSPLKIEKDIQNLLGQ 166

Length = 167

>gnl\|CDD\|178021 PLN02399, PLN02399, phospholipid hydroperoxide glutathione peroxidase	Back alignment and domain information

>gnl\|CDD\|238207 cd00340, GSH_Peroxidase, Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate	Back alignment and domain information

>gnl\|CDD\|223463 COG0386, BtuE, Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|173495 PTZ00256, PTZ00256, glutathione peroxidase; Provisional	Back alignment and domain information

>gnl\|CDD\|182585 PRK10606, btuE, putative glutathione peroxidase; Provisional	Back alignment and domain information

>gnl\|CDD\|201117 pfam00255, GSHPx, Glutathione peroxidase	Back alignment and domain information

>gnl\|CDD\|240248 PTZ00056, PTZ00056, glutathione peroxidase; Provisional	Back alignment and domain information

>gnl\|CDD\|131592 TIGR02540, gpx7, putative glutathione peroxidase Gpx7	Back alignment and domain information

>gnl\|CDD\|239264 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins	Back alignment and domain information

>gnl\|CDD\|216002 pfam00578, AhpC-TSA, AhpC/TSA family	Back alignment and domain information

>gnl\|CDD\|239267 cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs	Back alignment and domain information

>gnl\|CDD\|219888 pfam08534, Redoxin, Redoxin	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		204
PLN02399		236	phospholipid hydroperoxide glutathione peroxidase	100.0
PLN02412		167	probable glutathione peroxidase	100.0
PTZ00056		199	glutathione peroxidase; Provisional	100.0
cd00340		152	GSH_Peroxidase Glutathione (GSH) peroxidase family	99.98
PRK10606		183	btuE putative glutathione peroxidase; Provisional	99.97
PTZ00256		183	glutathione peroxidase; Provisional	99.97
TIGR02540		153	gpx7 putative glutathione peroxidase Gpx7. This mo	99.97
PRK15412		185	thiol:disulfide interchange protein DsbE; Provisio	99.96
COG0386		162	BtuE Glutathione peroxidase [Posttranslational mod	99.96
PRK03147		173	thiol-disulfide oxidoreductase; Provisional	99.96
KOG1651		171	consensus Glutathione peroxidase [Posttranslationa	99.94
TIGR00385		173	dsbE periplasmic protein thiol:disulfide oxidoredu	99.94
PF08534		146	Redoxin: Redoxin; InterPro: IPR013740 This redoxin	99.94
PRK14018		521	trifunctional thioredoxin/methionine sulfoxide red	99.94
cd02969		171	PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot	99.94
COG1225		157	Bcp Peroxiredoxin [Posttranslational modification,	99.93
PRK09437		154	bcp thioredoxin-dependent thiol peroxidase; Review	99.93
PF00578		124	AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per	99.93
cd03017		140	PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit	99.93
cd03010		127	TlpA_like_DsbE TlpA-like family, DsbE (also known	99.92
TIGR02661		189	MauD methylamine dehydrogenase accessory protein M	99.92
cd03015		173	PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-	99.92
cd03012		126	TlpA_like_DipZ_like TlpA-like family, DipZ-like su	99.92
PRK00522		167	tpx lipid hydroperoxide peroxidase; Provisional	99.92
TIGR03137		187	AhpC peroxiredoxin. This gene contains two invaria	99.91
cd03018		149	PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik	99.91
cd03014		143	PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical	99.91
cd02968		142	SCO SCO (an acronym for Synthesis of Cytochrome c	99.9
COG1999		207	Uncharacterized protein SCO1/SenC/PrrC, involved i	99.9
PRK13190		202	putative peroxiredoxin; Provisional	99.9
PRK13599		215	putative peroxiredoxin; Provisional	99.9
TIGR01626		184	ytfJ_HI0045 conserved hypothetical protein YtfJ-fa	99.89
cd02967		114	mauD Methylamine utilization (mau) D family; mauD	99.89
cd03008		146	TryX_like_RdCVF Tryparedoxin (TryX)-like family, R	99.89
cd03011		123	TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso	99.89
cd02971		140	PRX_family Peroxiredoxin (PRX) family; composed of	99.89
PF02630		174	SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam	99.89
PRK10382		187	alkyl hydroperoxide reductase subunit C; Provision	99.89
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	99.89
cd03016		203	PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub	99.88
PRK13191		215	putative peroxiredoxin; Provisional	99.88
PRK15000		200	peroxidase; Provisional	99.88
PRK13728		181	conjugal transfer protein TrbB; Provisional	99.88
cd02970		149	PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot	99.87
PRK13189		222	peroxiredoxin; Provisional	99.87
PTZ00137		261	2-Cys peroxiredoxin; Provisional	99.87
cd02966		116	TlpA_like_family TlpA-like family; composed of Tlp	99.86
PTZ00253		199	tryparedoxin peroxidase; Provisional	99.85
cd02964		132	TryX_like_family Tryparedoxin (TryX)-like family;	99.85
cd03009		131	TryX_like_TryX_NRX Tryparedoxin (TryX)-like family	99.85
TIGR02738		153	TrbB type-F conjugative transfer system pilin asse	99.83
PF13905		95	Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_	99.81
KOG2792		280	consensus Putative cytochrome C oxidase assembly p	99.79
cd03013		155	PRX5_like Peroxiredoxin (PRX) family, PRX5-like su	99.77
COG0450		194	AhpC Peroxiredoxin [Posttranslational modification	99.76
PF00255		108	GSHPx: Glutathione peroxidase; InterPro: IPR000889	99.76
cd02950		142	TxlA TRX-like protein A (TxlA) family; TxlA was or	99.73
cd02985		103	TRX_CDSP32 TRX family, chloroplastic drought-induc	99.65
KOG0855		211	consensus Alkyl hydroperoxide reductase, thiol spe	99.6
KOG2501		157	consensus Thioredoxin, nucleoredoxin and related p	99.58
cd02963		111	TRX_DnaJ TRX domain, DnaJ domain containing protei	99.56
TIGR02740		271	TraF-like TraF-like protein. This protein is relat	99.55
cd02953		104	DsbDgamma DsbD gamma family; DsbD gamma is the C-t	99.55
KOG0910		150	consensus Thioredoxin-like protein [Posttranslatio	99.54
cd02951		125	SoxW SoxW family; SoxW is a bacterial periplasmic	99.54
cd02948		102	TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus	99.51
cd02999		100	PDI_a_ERp44_like PDIa family, endoplasmic reticulu	99.51
cd02956		96	ybbN ybbN protein family; ybbN is a hypothetical p	99.5
PF13098		112	Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_	99.46
PRK09381		109	trxA thioredoxin; Provisional	99.46
cd03003		101	PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam	99.44
PHA02278		103	thioredoxin-like protein	99.43
cd02954		114	DIM1 Dim1 family; Dim1 is also referred to as U5 s	99.42
PRK10996		139	thioredoxin 2; Provisional	99.42
COG3118		304	Thioredoxin domain-containing protein [Posttransla	99.41
cd02994		101	PDI_a_TMX PDIa family, TMX subfamily; composed of	99.41
cd02993		109	PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat	99.37
TIGR01295		122	PedC_BrcD bacteriocin transport accessory protein,	99.37
PTZ00443		224	Thioredoxin domain-containing protein; Provisional	99.36
cd03000		104	PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o	99.35
cd03004		104	PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam	99.35
cd03005		102	PDI_a_ERp46 PDIa family, endoplasmic reticulum pro	99.35
cd02962		152	TMX2 TMX2 family; composed of proteins similar to	99.35
cd02949		97	TRX_NTR TRX domain, novel NADPH thioredoxin reduct	99.34
cd03006		113	PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil	99.34
KOG0907		106	consensus Thioredoxin [Posttranslational modificat	99.33
KOG0852		196	consensus Alkyl hydroperoxide reductase, thiol spe	99.33
cd03002		109	PDI_a_MPD1_like PDI family, MPD1-like subfamily; c	99.32
TIGR01126		102	pdi_dom protein disulfide-isomerase domain. This m	99.32
cd02959		117	ERp19 Endoplasmic reticulum protein 19 (ERp19) fam	99.3
PLN00410		142	U5 snRNP protein, DIM1 family; Provisional	99.3
TIGR01068		101	thioredoxin thioredoxin. Several proteins, such as	99.3
cd02996		108	PDI_a_ERp44 PDIa family, endoplasmic reticulum pro	99.25
cd02997		104	PDI_a_PDIR PDIa family, PDIR subfamily; composed o	99.25
PRK00293		571	dipZ thiol:disulfide interchange protein precursor	99.25
PF00085		103	Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio	99.24
COG2077		158	Tpx Peroxiredoxin [Posttranslational modification,	99.21
cd03065		120	PDI_b_Calsequestrin_N PDIb family, Calsequestrin s	99.19
cd02984		97	TRX_PICOT TRX domain, PICOT (for PKC-interacting c	99.19
cd02998		105	PDI_a_ERp38 PDIa family, endoplasmic reticulum pro	99.17
PTZ00051		98	thioredoxin; Provisional	99.16
PTZ00102		477	disulphide isomerase; Provisional	99.15
cd02961		101	PDI_a_family Protein Disulfide Isomerase (PDIa) fa	99.14
cd02955		124	SSP411 TRX domain, SSP411 protein family; members	99.13
cd02986		114	DLP Dim1 family, Dim1-like protein (DLP) subfamily	99.13
PF00837		237	T4_deiodinase: Iodothyronine deiodinase; InterPro:	99.12
KOG0854		224	consensus Alkyl hydroperoxide reductase, thiol spe	99.12
cd03001		103	PDI_a_P5 PDIa family, P5 subfamily; composed of eu	99.11
PTZ00102		477	disulphide isomerase; Provisional	99.08
cd02975		113	PfPDO_like_N Pyrococcus furiosus protein disulfide	99.08
TIGR00411		82	redox_disulf_1 small redox-active disulfide protei	99.07
cd02965		111	HyaE HyaE family; HyaE is also called HupG and Hox	99.07
cd02992		114	PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas	99.06
cd02957		113	Phd_like Phosducin (Phd)-like family; composed of	99.05
cd02995		104	PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain	99.03
TIGR00424		463	APS_reduc 5'-adenylylsulfate reductase, thioredoxi	99.0
cd02947		93	TRX_family TRX family; composed of two groups: Gro	98.99
cd02958		114	UAS UAS family; UAS is a domain of unknown functio	98.98
cd02989		113	Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior	98.97
cd02987		175	Phd_like_Phd Phosducin (Phd)-like family, Phd subf	98.96
cd02952		119	TRP14_like Human TRX-related protein 14 (TRP14)-li	98.92
PLN02309		457	5'-adenylylsulfate reductase	98.9
cd02988		192	Phd_like_VIAF Phosducin (Phd)-like family, Viral i	98.9
TIGR01130		462	ER_PDI_fam protein disulfide isomerases, eukaryoti	98.88
PTZ00062		204	glutaredoxin; Provisional	98.86
PF13728		215	TraF: F plasmid transfer operon protein	98.85
TIGR00412		76	redox_disulf_2 small redox-active disulfide protei	98.85
TIGR02739		256	TraF type-F conjugative transfer system pilin asse	98.8
cd02960		130	AGR Anterior Gradient (AGR) family; members of thi	98.78
KOG0908		288	consensus Thioredoxin-like protein [Posttranslatio	98.77
PRK13703		248	conjugal pilus assembly protein TraF; Provisional	98.74
cd02982		103	PDI_b'_family Protein Disulfide Isomerase (PDIb')	98.74
TIGR01130		462	ER_PDI_fam protein disulfide isomerases, eukaryoti	98.71
TIGR02187		215	GlrX_arch Glutaredoxin-like domain protein. This f	98.65
COG4232		569	Thiol:disulfide interchange protein [Posttranslati	98.55
PF14595		129	Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A.	98.55
TIGR02187		215	GlrX_arch Glutaredoxin-like domain protein. This f	98.52
KOG0190		493	consensus Protein disulfide isomerase (prolyl 4-hy	98.49
cd03026		89	AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid	98.43
smart00594		122	UAS UAS domain.	98.42
PHA02125		75	thioredoxin-like protein	98.36
cd02973		67	TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-	98.33
COG2143		182	Thioredoxin-related protein [Posttranslational mod	98.32
COG0526		127	TrxA Thiol-disulfide isomerase and thioredoxins [P	98.28
cd01659		69	TRX_superfamily Thioredoxin (TRX) superfamily; a l	98.16
PF13899		82	Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_	98.15
TIGR02196		74	GlrX_YruB Glutaredoxin-like protein, YruB-family.	98.03
KOG0912		375	consensus Thiol-disulfide isomerase and thioredoxi	97.97
cd02991		116	UAS_ETEA UAS family, ETEA subfamily; composed of p	97.96
KOG0191		383	consensus Thioredoxin/protein disulfide isomerase	97.95
KOG1731		606	consensus FAD-dependent sulfhydryl oxidase/quiesci	97.92
KOG0190		493	consensus Protein disulfide isomerase (prolyl 4-hy	97.86
PF04592		238	SelP_N: Selenoprotein P, N terminal region; InterP	97.8
PRK11657		251	dsbG disulfide isomerase/thiol-disulfide oxidase;	97.79
PF09695		160	YtfJ_HI0045: Bacterial protein of unknown function	97.77
cd03007		116	PDI_a_ERp29_N PDIa family, endoplasmic reticulum p	97.69
PF06110		119	DUF953: Eukaryotic protein of unknown function (DU	97.66
PF05176		252	ATP-synt_10: ATP10 protein; InterPro: IPR007849 Th	97.62
PF03190		163	Thioredox_DsbH: Protein of unknown function, DUF25	97.59
TIGR02200		77	GlrX_actino Glutaredoxin-like protein. This family	97.55
TIGR02180		84	GRX_euk Glutaredoxin. This model represents eukary	97.53
COG0678		165	AHP1 Peroxiredoxin [Posttranslational modification	97.52
PRK10877		232	protein disulfide isomerase II DsbC; Provisional	97.47
PF13192		76	Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY	97.47
cd03019		178	DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m	97.2
cd03020		197	DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil	97.15
PRK11509		132	hydrogenase-1 operon protein HyaE; Provisional	97.12
KOG4277		468	consensus Uncharacterized conserved protein, conta	97.09
PF05988		211	DUF899: Bacterial protein of unknown function (DUF	97.08
PF13778		118	DUF4174: Domain of unknown function (DUF4174)	97.03
PF13911		115	AhpC-TSA_2: AhpC/TSA antioxidant enzyme	96.99
KOG0191		383	consensus Thioredoxin/protein disulfide isomerase	96.89
KOG3425		128	consensus Uncharacterized conserved protein [Funct	96.65
cd03023		154	DsbA_Com1_like DsbA family, Com1-like subfamily; c	96.65
COG1651		244	DsbG Protein-disulfide isomerase [Posttranslationa	96.49
KOG0541		171	consensus Alkyl hydroperoxide reductase/peroxiredo	96.41
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	96.32
PHA03050		108	glutaredoxin; Provisional	96.25
PRK11200		85	grxA glutaredoxin 1; Provisional	96.23
PF02114		265	Phosducin: Phosducin; InterPro: IPR024253 The oute	96.22
cd03419		82	GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h	96.21
PF13462		162	Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV	96.18
cd02976		73	NrdH NrdH-redoxin (NrdH) family; NrdH is a small m	95.62
KOG4498		197	consensus Uncharacterized conserved protein [Funct	95.5
COG3054		184	Predicted transcriptional regulator [General funct	95.49
cd03418		75	GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b	95.39
TIGR02183		86	GRXA Glutaredoxin, GrxA family. This model include	95.37
PF00462		60	Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl	95.16
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	94.98
cd02066		72	GRX_family Glutaredoxin (GRX) family; composed of	94.96
cd02972		98	DsbA_family DsbA family; consists of DsbA and DsbA	94.94
TIGR02181		79	GRX_bact Glutaredoxin, GrxC family. This family of	94.82
PF06053		249	DUF929: Domain of unknown function (DUF929); Inter	94.82
COG4312		247	Uncharacterized protein conserved in bacteria [Fun	94.64
cd03027		73	GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg	94.41
COG0695		80	GrxC Glutaredoxin and related proteins [Posttransl	94.29
KOG0914		265	consensus Thioredoxin-like protein [Posttranslatio	94.24
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	94.23
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	94.22
PHA03075		123	glutaredoxin-like protein; Provisional	94.0
TIGR02189		99	GlrX-like_plant Glutaredoxin-like family. This fam	93.78
TIGR02190		79	GlrX-dom Glutaredoxin-family domain. This C-termin	93.77
COG4545		85	Glutaredoxin-related protein [Posttranslational mo	93.7
PF11009		105	DUF2847: Protein of unknown function (DUF2847); In	93.39
PRK10329		81	glutaredoxin-like protein; Provisional	93.29
TIGR00995		270	3a0901s06TIC22 chloroplast protein import componen	93.05
TIGR00365		97	monothiol glutaredoxin, Grx4 family. The gene for	92.86
PRK10954		207	periplasmic protein disulfide isomerase I; Provisi	92.72
COG1331		667	Highly conserved protein containing a thioredoxin	92.71
KOG0913		248	consensus Thiol-disulfide isomerase and thioredoxi	92.6
TIGR01617		117	arsC_related transcriptional regulator, Spx/MgsR f	92.59
KOG1752		104	consensus Glutaredoxin and related proteins [Postt	92.35
cd03028		90	GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte	92.27
TIGR02194		72	GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red	91.84
PRK10638		83	glutaredoxin 3; Provisional	91.82
cd03036		111	ArsC_like Arsenate Reductase (ArsC) family, unknow	91.66
cd03032		115	ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub	91.54
cd02977		105	ArsC_family Arsenate Reductase (ArsC) family; comp	91.32
cd03029		72	GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb	90.82
PRK01655		131	spxA transcriptional regulator Spx; Reviewed	90.62
cd02983		130	P5_C P5 family, C-terminal redox inactive TRX-like	89.96
KOG0911		227	consensus Glutaredoxin-related protein [Posttransl	89.34
PRK10824		115	glutaredoxin-4; Provisional	88.8
PRK12559		131	transcriptional regulator Spx; Provisional	87.81
KOG3414		142	consensus Component of the U4/U6.U5 snRNP/mitosis	87.46
KOG2507		506	consensus Ubiquitin regulatory protein UBXD2, cont	87.18
cd03035		105	ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s	86.01
PF05768		81	DUF836: Glutaredoxin-like domain (DUF836); InterPr	85.83
KOG4614		287	consensus Inner membrane protein required for asse	85.48
PRK13344		132	spxA transcriptional regulator Spx; Reviewed	84.76
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	83.85
PF13848		184	Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_	83.63
PF01216		383	Calsequestrin: Calsequestrin; InterPro: IPR001393	82.94
KOG1672		211	consensus ATP binding protein [Posttranslational m	82.27
PTZ00062		204	glutaredoxin; Provisional	80.14

>PLN02399 phospholipid hydroperoxide glutathione peroxidase	Back alignment and domain information

Probab=100.00  E-value=7.2e-34  Score=216.98  Aligned_cols=162  Identities=74%  Similarity=1.228  Sum_probs=143.6

Q ss_pred             CCCcccceEEecCCCCeeecCCCCCcEEEEEEeccCCCCCHHhHHHHHHHHHHhcCCCeEEEEEeCCCCCCCCCCCHHHH
Q 028736           42 APKSIYDFTVKDIRGNDVSLSGYRGKVLLVVNVASKCGLTQSNYKELNVLYEKYKNQDFEVLAFPCNQFAGQEPGSNEEI  121 (204)
Q Consensus        42 ~~~~~p~~~l~~~~g~~~~l~~~~gk~~lv~f~~t~C~~C~~~~~~l~~l~~~~~~~~~~~i~v~~d~~~~~~~~~~~~~  121 (204)
                      .++.+|+|++.|.+|+.+++++++||++||+||++|||+|..+++.|++++++++++++++|+|++|.+..+++++.+++
T Consensus        75 ~g~~aPdF~l~d~~G~~vsLsd~kGK~vvl~FwAswCp~c~~e~p~L~~L~~~~~~~Gv~VIgV~~d~~~~~e~~s~~ei  154 (236)
T PLN02399         75 TEKSVHDFTVKDIDGKDVALSKFKGKVLLIVNVASKCGLTSSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEI  154 (236)
T ss_pred             cCCCCCceEEECCCCCEEeHHHhCCCeEEEEEEcCCCcchHHHHHHHHHHHHHHhcCCcEEEEEecccccccCCCCHHHH
Confidence            78899999999999999999999999999999999999999999999999999999999999999998777777889999


Q ss_pred             HHHHHhhcCccccceeeccCCCCCchhHHHHHHhhcCCccccccccceeeEEECCCCcEEEecCCCCChhHHHHHHHHhh
Q 028736          122 QEVACTMFKAEFPIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLL  201 (204)
Q Consensus       122 ~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~i~~~P~~~lid~~G~i~~~~~g~~~~~~~~~~l~~ll  201 (204)
                      ++|+.++++.+||++.+.|.++......|++++...++..++.+.|+|++||||++|+|++++.|..+++++++.|+++|
T Consensus       155 ~~f~~~~~g~~fPvl~~~D~~G~~~~~~y~~l~~~~~~~~g~~i~~~PttfLIDk~GkVv~~~~G~~~~~~le~~I~~lL  234 (236)
T PLN02399        155 KQFACTRFKAEFPIFDKVDVNGPSTAPVYQFLKSNAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTSPFQIEKDIQKLL  234 (236)
T ss_pred             HHHHHHhcCCCCccccccCCCcchhhHHHHHHHHhcCCccCCccccCceEEEECCCCcEEEEECCCCCHHHHHHHHHHHh
Confidence            99986667999999865667777777788877554444434467889999999999999999999999999999999998


Q ss_pred             hc
Q 028736          202 GS  203 (204)
Q Consensus       202 ~~  203 (204)
                      +.
T Consensus       235 ~~  236 (236)
T PLN02399        235 AA  236 (236)
T ss_pred             cC
Confidence            63

>PLN02412 probable glutathione peroxidase	Back alignment and domain information

>PTZ00056 glutathione peroxidase; Provisional	Back alignment and domain information

>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate	Back alignment and domain information

>PRK10606 btuE putative glutathione peroxidase; Provisional	Back alignment and domain information

>PTZ00256 glutathione peroxidase; Provisional	Back alignment and domain information

>TIGR02540 gpx7 putative glutathione peroxidase Gpx7	Back alignment and domain information

>PRK15412 thiol:disulfide interchange protein DsbE; Provisional	Back alignment and domain information

>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03147 thiol-disulfide oxidoreductase; Provisional	Back alignment and domain information

>KOG1651 consensus Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily	Back alignment and domain information

>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins	Back alignment and domain information

>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional	Back alignment and domain information

>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs	Back alignment and domain information

>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed	Back alignment and domain information

>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells	Back alignment and domain information

>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides	Back alignment and domain information

>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif	Back alignment and domain information

>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD	Back alignment and domain information

>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides	Back alignment and domain information

>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain	Back alignment and domain information

>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional	Back alignment and domain information

>TIGR03137 AhpC peroxiredoxin	Back alignment and domain information

>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE	Back alignment and domain information

>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx)	Back alignment and domain information

>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold	Back alignment and domain information

>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only]	Back alignment and domain information

>PRK13190 putative peroxiredoxin; Provisional	Back alignment and domain information

>PRK13599 putative peroxiredoxin; Provisional	Back alignment and domain information

>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626	Back alignment and domain information

>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source	Back alignment and domain information

>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors	Back alignment and domain information

>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif	Back alignment and domain information

>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified	Back alignment and domain information

>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems	Back alignment and domain information

>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine	Back alignment and domain information

>PRK13191 putative peroxiredoxin; Provisional	Back alignment and domain information

>PRK15000 peroxidase; Provisional	Back alignment and domain information

>PRK13728 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs	Back alignment and domain information

>PRK13189 peroxiredoxin; Provisional	Back alignment and domain information

>PTZ00137 2-Cys peroxiredoxin; Provisional	Back alignment and domain information

>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins	Back alignment and domain information

>PTZ00253 tryparedoxin peroxidase; Provisional	Back alignment and domain information

>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX	Back alignment and domain information

>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif	Back alignment and domain information

>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	Back alignment and domain information

>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A	Back alignment and domain information

>KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion]	Back alignment and domain information

>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol	Back alignment and domain information

>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00255 GSHPx: Glutathione peroxidase; InterPro: IPR000889 Glutathione peroxidase (GSHPx) (1	Back alignment and domain information

>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus	Back alignment and domain information

>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif	Back alignment and domain information

>KOG0855 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only]	Back alignment and domain information

>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain	Back alignment and domain information

>TIGR02740 TraF-like TraF-like protein	Back alignment and domain information

>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD	Back alignment and domain information

>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation	Back alignment and domain information

>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein	Back alignment and domain information

>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44	Back alignment and domain information

>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain	Back alignment and domain information

>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A	Back alignment and domain information

>PRK09381 trxA thioredoxin; Provisional	Back alignment and domain information

>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>PHA02278 thioredoxin-like protein	Back alignment and domain information

>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein	Back alignment and domain information

>PRK10996 thioredoxin 2; Provisional	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX	Back alignment and domain information

>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases	Back alignment and domain information

>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative	Back alignment and domain information

>PTZ00443 Thioredoxin domain-containing protein; Provisional	Back alignment and domain information

>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus	Back alignment and domain information

>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains	Back alignment and domain information

>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library	Back alignment and domain information

>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains	Back alignment and domain information

>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox	Back alignment and domain information

>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0852 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein	Back alignment and domain information

>TIGR01126 pdi_dom protein disulfide-isomerase domain	Back alignment and domain information

>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain	Back alignment and domain information

>PLN00410 U5 snRNP protein, DIM1 family; Provisional	Back alignment and domain information

>TIGR01068 thioredoxin thioredoxin	Back alignment and domain information

>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention	Back alignment and domain information

>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related)	Back alignment and domain information

>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional	Back alignment and domain information

>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms	Back alignment and domain information

>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle	Back alignment and domain information

>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes	Back alignment and domain information

>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5	Back alignment and domain information

>PTZ00051 thioredoxin; Provisional	Back alignment and domain information

>PTZ00102 disulphide isomerase; Provisional	Back alignment and domain information

>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif	Back alignment and domain information

>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1	Back alignment and domain information

>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1	Back alignment and domain information

>KOG0854 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain)	Back alignment and domain information

>PTZ00102 disulphide isomerase; Provisional	Back alignment and domain information

>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding	Back alignment and domain information

>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1	Back alignment and domain information

>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO	Back alignment and domain information

>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein	Back alignment and domain information

>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions	Back alignment and domain information

>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1	Back alignment and domain information

>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent	Back alignment and domain information

>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains	Back alignment and domain information

>cd02958 UAS UAS family; UAS is a domain of unknown function	Back alignment and domain information

>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif	Back alignment and domain information

>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions	Back alignment and domain information

>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1	Back alignment and domain information

>PLN02309 5'-adenylylsulfate reductase	Back alignment and domain information

>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis	Back alignment and domain information

>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic	Back alignment and domain information

>PTZ00062 glutaredoxin; Provisional	Back alignment and domain information

>PF13728 TraF: F plasmid transfer operon protein	Back alignment and domain information

>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2	Back alignment and domain information

>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF	Back alignment and domain information

>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus	Back alignment and domain information

>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13703 conjugal pilus assembly protein TraF; Provisional	Back alignment and domain information

>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic	Back alignment and domain information

>TIGR02187 GlrX_arch Glutaredoxin-like domain protein	Back alignment and domain information

>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]	Back alignment and domain information

>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A	Back alignment and domain information

>TIGR02187 GlrX_arch Glutaredoxin-like domain protein	Back alignment and domain information

>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides	Back alignment and domain information

>smart00594 UAS UAS domain	Back alignment and domain information

>PHA02125 thioredoxin-like protein	Back alignment and domain information

>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)	Back alignment and domain information

>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]	Back alignment and domain information

>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold	Back alignment and domain information

>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A	Back alignment and domain information

>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family	Back alignment and domain information

>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion]	Back alignment and domain information

>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals	Back alignment and domain information

>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04592 SelP_N: Selenoprotein P, N terminal region; InterPro: IPR007671 SelP is the only known eukaryotic selenoprotein that contains multiple selenocysteine (Sec) residues, and accounts for more than 50% of the selenium content of rat and human plasma []	Back alignment and domain information

>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional	Back alignment and domain information

>PF09695 YtfJ_HI0045: Bacterial protein of unknown function (YtfJ_HI0045); InterPro: IPR006513 These are sequences from gammaproteobacteria that are related to the Escherichia coli protein, YtfJ	Back alignment and domain information

>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells	Back alignment and domain information

>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like	Back alignment and domain information

>PF05176 ATP-synt_10: ATP10 protein; InterPro: IPR007849 This entry represents the ATPase assembly factor ATP10 found in mitochondria, which is essential for the assembly of the mitochondrial F1-F0 complex	Back alignment and domain information

>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins	Back alignment and domain information

>TIGR02200 GlrX_actino Glutaredoxin-like protein	Back alignment and domain information

>TIGR02180 GRX_euk Glutaredoxin	Back alignment and domain information

>COG0678 AHP1 Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10877 protein disulfide isomerase II DsbC; Provisional	Back alignment and domain information

>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B	Back alignment and domain information

>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold	Back alignment and domain information

>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold	Back alignment and domain information

>PRK11509 hydrogenase-1 operon protein HyaE; Provisional	Back alignment and domain information

>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only]	Back alignment and domain information

>PF05988 DUF899: Bacterial protein of unknown function (DUF899); InterPro: IPR010296 This family consists of uncharacterised bacterial proteins of unknown function which are thioredoxin-like	Back alignment and domain information

>PF13778 DUF4174: Domain of unknown function (DUF4174)	Back alignment and domain information

>PF13911 AhpC-TSA_2: AhpC/TSA antioxidant enzyme	Back alignment and domain information

>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3425 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti	Back alignment and domain information

>COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0541 consensus Alkyl hydroperoxide reductase/peroxiredoxin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PHA03050 glutaredoxin; Provisional	Back alignment and domain information

>PRK11200 grxA glutaredoxin 1; Provisional	Back alignment and domain information

>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin	Back alignment and domain information

>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A	Back alignment and domain information

>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile	Back alignment and domain information

>KOG4498 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG3054 Predicted transcriptional regulator [General function prediction only]	Back alignment and domain information

>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>TIGR02183 GRXA Glutaredoxin, GrxA family	Back alignment and domain information

>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins	Back alignment and domain information

>TIGR02181 GRX_bact Glutaredoxin, GrxC family	Back alignment and domain information

>PF06053 DUF929: Domain of unknown function (DUF929); InterPro: IPR009272 This is a family of proteins from the archaeon Sulfolobus, with undetermined function	Back alignment and domain information

>COG4312 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions	Back alignment and domain information

>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>PHA03075 glutaredoxin-like protein; Provisional	Back alignment and domain information

>TIGR02189 GlrX-like_plant Glutaredoxin-like family	Back alignment and domain information

>TIGR02190 GlrX-dom Glutaredoxin-family domain	Back alignment and domain information

>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol	Back alignment and domain information

>PRK10329 glutaredoxin-like protein; Provisional	Back alignment and domain information

>TIGR00995 3a0901s06TIC22 chloroplast protein import component, Tic22 family	Back alignment and domain information

>TIGR00365 monothiol glutaredoxin, Grx4 family	Back alignment and domain information

>PRK10954 periplasmic protein disulfide isomerase I; Provisional	Back alignment and domain information

>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion]	Back alignment and domain information

>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family	Back alignment and domain information

>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins	Back alignment and domain information

>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH	Back alignment and domain information

>PRK10638 glutaredoxin 3; Provisional	Back alignment and domain information

>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC	Back alignment and domain information

>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes	Back alignment and domain information

>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx	Back alignment and domain information

>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria	Back alignment and domain information

>PRK01655 spxA transcriptional regulator Spx; Reviewed	Back alignment and domain information

>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain)	Back alignment and domain information

>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10824 glutaredoxin-4; Provisional	Back alignment and domain information

>PRK12559 transcriptional regulator Spx; Provisional	Back alignment and domain information

>KOG3414 consensus Component of the U4/U6	Back alignment and domain information

>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]	Back alignment and domain information

>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC	Back alignment and domain information

>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>KOG4614 consensus Inner membrane protein required for assembly of the F0 sector of ATP synthase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13344 spxA transcriptional regulator Spx; Reviewed	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A	Back alignment and domain information

>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle []	Back alignment and domain information

>KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion]	Back alignment and domain information

>PTZ00062 glutaredoxin; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		204
2p5q_A		170	Crystal Structure Of The Poplar Glutathione Peroxid		7e-64
3e0u_A		166	Crystal Structure Of T. Cruzi Gpx1 Length = 166		2e-45
2vup_A		190	Crystal Structure Of A Type Ii Tryparedoxin-Dependa		2e-44
3dwv_A		187	Glutathione Peroxidase-Type Tryparedoxin Peroxidase		2e-44
2wgr_A		169	Combining Crystallography And Molecular Dynamics: T		3e-44
2v1m_A		169	Crystal Structure Of Schistosoma Mansoni Glutathion		4e-44
2rm5_A		167	Glutathione Peroxidase-Type Tryparedoxin Peroxidase		8e-44
2obi_A		183	Crystal Structure Of The Selenocysteine To Cysteine		2e-41
3cmi_A		171	Crystal Structure Of Glutathione-Dependent Phosphol		2e-40
2gs3_A		185	Crystal Structure Of The Selenocysteine To Glycine		5e-40
2p31_A		181	Crystal Structure Of Human Glutathione Peroxidase 7		2e-32
3cyn_A		189	The Structure Of Human Gpx8 Length = 189		1e-29
3kij_A		180	Crystal Structure Of The Human Pdi-Peroxidase Lengt		4e-29
1gp1_A		198	The Refined Structure Of The Selenoenzyme Glutathio		1e-23
2f8a_A		208	Crystal Structure Of The Selenocysteine To Glycine		2e-23
2he3_A		208	Crystal Structure Of The Selenocysteine To Cysteine		7e-22
2i3y_A		215	Crystal Structure Of Human Glutathione Peroxidase 5		4e-21
2r37_A		207	Crystal Structure Of Human Glutathione Peroxidase 3		6e-19
2lrt_A		152	Solution Structure Of The Uncharacterized Thioredox		4e-04
2lja_A		152	Solution Structure Of A Putative Thiol-Disulfide Ox		5e-04

>pdb|2P5Q|A Chain A, Crystal Structure Of The Poplar Glutathione Peroxidase 5 In The Reduced Form Length = 170