Citrus Sinensis ID: 028742

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----

MACLHDHSCEDHDCSSDWSLYKHIDLSKVSALNEAVPGSVKSVFKAWEQRLNSSGEHLESNDGDPELLVYIPFTTDVKIKSISIVGGADGTSPSKMRVFINREGIDFSDAQDMQAIQEWDLVENLQGVLEYQTRYSKFQSVANITLHFPDNFGGDTTQIHYIGLKGEATQLKRDVVATIVYELRPNPSDHKTKSESGGGLSHVE

cccccccccccccccccccccccccccccEEEcccccccccEEEEccHHHHcccccccccccccccEEEEEEccccEEEEEEEEEcccccccccEEEEEEccccccccccccccccEEEEEEccccccEEEEccccccccccEEEEEEEccccccEEEEEEEEEEEEEcccccccEEEEEEEcccccccccccccccccccccc

***************SDWSLYKHIDLSKVSALNEAVPGSVKSVFKAWEQRL********SNDGDPELLVYIPFTTDVKIKSISIVGGADGTSPSKMRVFINREGIDFSDAQDMQAIQEWDLVENLQGVLEYQTRYSKFQSVANITLHFPDNFGGDTTQIHYIGLKGEATQLKRDVVATIVYELRPNP*****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
PITH domain-containing protein 1		probable	Q54Z24
PITH domain-containing protein GA19395		probable	Q29L80
PITH domain-containing protein 1		probable	Q8BWR2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WWY, chain A
Confidence level:confident
Coverage over the Query: 11-188
View the alignment between query and template
View the model in PyMOL