Citrus Sinensis ID: 028761


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MTAQTQEELLASLLEQQKIDDDKPVVEDDEDEDEDEDEDDEKDEDEADEGHRDGEAGGRSKQSRSEKKSRKAMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTTDTYVIFGEAKIEDLSSQLQTQAAEQFKAPDLSHVVSKPESSAMAQDDEEVDETGVEPKDIELVMTQAGVSRAKAVKALKAADGDIVSAIMELTN
ccHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHcccccccccccccccccHHHHHHHHHHHcccCCcccEEEEEEECcccEEEEECccCEECcccccEEEEEccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHHHHHHHccccHHHHHHHccc
***************************************************************************LGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTTDTYVIFGEAKI*******************************************VEPKDIELVMTQAGVSRAKAVKALKAADGDIVSAIMELT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAQTQEELLASLLEQQKIDDDKPVVEDDEDEDEDEDEDDEKDEDEADEGHRDGEAGGRSKQSRSEKKSRKAMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTTDTYVIFGEAKIEDLSSQLQTQAAEQFKAPDLSHVVSKPESSAMAQDDEEVDETGVEPKDIELVMTQAGVSRAKAVKALKAADGDIVSAIMELTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nascent polypeptide-associated complex subunit alpha-like protein 1 May promote appropriate targeting of ribosome-nascent polypeptide complexes.confidentQ9LHG9
Nascent polypeptide-associated complex subunit alpha-like protein May promote appropriate targeting of ribosome-nascent polypeptide complexes.probableQ9M612
Nascent polypeptide-associated complex subunit alpha May promote appropriate targeting of ribosome-nascent polypeptide complexes.probableQ86S66

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TR8, chain A
Confidence level:confident
Coverage over the Query: 79-129,165-199
View the alignment between query and template
View the model in PyMOL